Rattus norvegicus (rat): 103691088 Help Entry 103691088         CDS       T01003                                  Symbol Elocl1 Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism rno  Rattus norvegicus (rat) Pathway rno04066   HIF-1 signaling pathway rno04120   Ubiquitin mediated proteolysis rno05170   Human immunodeficiency virus 1 infection rno05200   Pathways in cancer rno05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103691088 (Elocl1)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103691088 (Elocl1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103691088 (Elocl1)   09162 Cancer: specific types    05211 Renal cell carcinoma     103691088 (Elocl1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103691088 (Elocl1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rno04121]     103691088 (Elocl1)    03400 DNA repair and recombination proteins [BR:rno03400]     103691088 (Elocl1) Ubiquitin system [BR:rno04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      103691088 (Elocl1)    Cul5 complex      103691088 (Elocl1) DNA repair and recombination proteins [BR:rno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103691088 (Elocl1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  103691088 NCBI-ProteinID:  XP_038945796 RGD:  9368177 Ensembl:  ENSRNOG00000061371 LinkDB All DBs Position 12:complement(22103409..22104061) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGYEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHALSKVCMYFTYRVRYTNSSTEIPEFPIAPEIALELLMAENFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaggagaaaacctatggtggctatgaaggccctgatgccatgtatgtgaaa ttaatatcttctgatggtcatgaatttattgtaaaaagagaacatgcattaacatcagga acaataaaggccatgttgagtggtccaggtcagtttgcggagaatgaaaccaatgaggtc aattttagagagatcccttcacatgcgctatcgaaagtgtgcatgtattttacctacagg gtccgctatactaacagctccactgaaattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggccgagaacttcctagattgttaa

DBGET integrated database retrieval system