Rattus norvegicus (rat): 116484 Help Entry 116484            CDS       T01003                                  Symbol Txn1 Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism rno  Rattus norvegicus (rat) Pathway rno04621   NOD-like receptor signaling pathway rno05012   Parkinson disease rno05132   Salmonella infection rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116484 (Txn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116484 (Txn1)   09164 Neurodegenerative disease    05012 Parkinson disease     116484 (Txn1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     116484 (Txn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rno03110]     116484 (Txn1) Chaperones and folding catalysts [BR:rno03110]  Protein folding catalysts   Protein disulfide isomerase    116484 (Txn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 AhpC-TSA Thioredoxin_7 OST3_OST6 Thioredoxin_9 Glutaredoxin Motif Other DBs NCBI-GeneID:  116484 NCBI-ProteinID:  NP_446252 RGD:  621157 Ensembl:  ENSRNOG00000012081 UniProt:  P11232 A6KDU1 LinkDB All DBs Position 5:complement(77507455..77519685) Genome browser AA seq 105 aa AA seqDB search MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATITEFA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggccgctgcgggagac aagcttgtggtagtggacttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctgtgacaagtattccaatgtggtgttccttgaagtagacgtggat gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttctat aaaaagggtcaaaaggttggggagttctctggtgctaacaaggaaaagctcgaagccact attacggagtttgcctaa

DBGET integrated database retrieval system