Rattus norvegicus (rat): 117273 Help Entry 117273            CDS       T01003                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism rno  Rattus norvegicus (rat) Pathway rno04014   Ras signaling pathway rno04015   Rap1 signaling pathway rno04022   cGMP-PKG signaling pathway rno04024   cAMP signaling pathway rno04062   Chemokine signaling pathway rno04071   Sphingolipid signaling pathway rno04072   Phospholipase D signaling pathway rno04081   Hormone signaling rno04144   Endocytosis rno04150   mTOR signaling pathway rno04270   Vascular smooth muscle contraction rno04310   Wnt signaling pathway rno04350   TGF-beta signaling pathway rno04360   Axon guidance rno04510   Focal adhesion rno04520   Adherens junction rno04530   Tight junction rno04611   Platelet activation rno04621   NOD-like receptor signaling pathway rno04625   C-type lectin receptor signaling pathway rno04660   T cell receptor signaling pathway rno04670   Leukocyte transendothelial migration rno04722   Neurotrophin signaling pathway rno04810   Regulation of actin cytoskeleton rno04921   Oxytocin signaling pathway rno04928   Parathyroid hormone synthesis, secretion and action rno04972   Pancreatic secretion rno05100   Bacterial invasion of epithelial cells rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05152   Tuberculosis rno05163   Human cytomegalovirus infection rno05200   Pathways in cancer rno05203   Viral carcinogenesis rno05205   Proteoglycans in cancer rno05206   MicroRNAs in cancer rno05210   Colorectal cancer rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     117273 (Rhoa)    04015 Rap1 signaling pathway     117273 (Rhoa)    04310 Wnt signaling pathway     117273 (Rhoa)    04350 TGF-beta signaling pathway     117273 (Rhoa)    04072 Phospholipase D signaling pathway     117273 (Rhoa)    04071 Sphingolipid signaling pathway     117273 (Rhoa)    04024 cAMP signaling pathway     117273 (Rhoa)    04022 cGMP-PKG signaling pathway     117273 (Rhoa)    04150 mTOR signaling pathway     117273 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     117273 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117273 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117273 (Rhoa)    04520 Adherens junction     117273 (Rhoa)    04530 Tight junction     117273 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117273 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     117273 (Rhoa)    04621 NOD-like receptor signaling pathway     117273 (Rhoa)    04625 C-type lectin receptor signaling pathway     117273 (Rhoa)    04660 T cell receptor signaling pathway     117273 (Rhoa)    04670 Leukocyte transendothelial migration     117273 (Rhoa)    04062 Chemokine signaling pathway     117273 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     117273 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     117273 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     117273 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     117273 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     117273 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     117273 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     117273 (Rhoa)    05206 MicroRNAs in cancer     117273 (Rhoa)    05205 Proteoglycans in cancer     117273 (Rhoa)    05203 Viral carcinogenesis     117273 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     117273 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     117273 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     117273 (Rhoa)    05135 Yersinia infection     117273 (Rhoa)    05133 Pertussis     117273 (Rhoa)    05152 Tuberculosis     117273 (Rhoa)    05100 Bacterial invasion of epithelial cells     117273 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     117273 (Rhoa)    05418 Fluid shear stress and atherosclerosis     117273 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     117273 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     117273 (Rhoa)    04031 GTP-binding proteins [BR:rno04031]     117273 (Rhoa) Membrane trafficking [BR:rno04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     117273 (Rhoa) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117273 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    117273 (Rhoa)   Exosomal proteins of colorectal cancer cells    117273 (Rhoa)   Exosomal proteins of bladder cancer cells    117273 (Rhoa) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     117273 (Rhoa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  117273 NCBI-ProteinID:  NP_476473 RGD:  619921 Ensembl:  ENSRNOG00000050519 UniProt:  P61589 A6I347 Structure PDBPDBj LinkDB All DBs Position 8:117870548..117904303 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacggtgtttgaa aactatgtggcagatattgaagtggacgggaagcaggtagagttggctttatgggacaca gctggacaggaagattatgaccgtctgaggcctctctcctacccagacactgatgttata ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtccaaatgtgcccatcatcctagttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagttagccaaaatgaagcaggagccggtaaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagacggagtgagagaggtttttgagatggccacgagagctgctctgcaa gctagacgcgggaagaaaaagtcggggtgcctcatcttgtga

DBGET integrated database retrieval system