Rattus norvegicus (rat): 120101895 Help Entry 120101895         CDS       T01003                                  Symbol Elob-ps5 Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism rno  Rattus norvegicus (rat) Pathway rno04066   HIF-1 signaling pathway rno04120   Ubiquitin mediated proteolysis rno05170   Human immunodeficiency virus 1 infection rno05200   Pathways in cancer rno05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120101895 (Elob-ps5)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     120101895 (Elob-ps5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120101895 (Elob-ps5)   09162 Cancer: specific types    05211 Renal cell carcinoma     120101895 (Elob-ps5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120101895 (Elob-ps5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rno04121]     120101895 (Elob-ps5)    03400 DNA repair and recombination proteins [BR:rno03400]     120101895 (Elob-ps5) Ubiquitin system [BR:rno04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      120101895 (Elob-ps5)    Cul5 complex      120101895 (Elob-ps5) DNA repair and recombination proteins [BR:rno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120101895 (Elob-ps5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_4 Rad60-SLD Motif Other DBs NCBI-GeneID:  120101895 NCBI-ProteinID:  XP_063140938 RGD:  41185658 LinkDB All DBs Position 3:41439065..41439946 Genome browser AA seq 102 aa AA seqDB search MDVFLMIRRHKTTTIFMDAKESSTVFELKCIVEGIIKRQPEEQRLYKDDQLLNDGKTLGE CGFTSQTARPQTPATVCLAFRADDTVEALLIEPFSSPRSFQM NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctcatgatccggcgccacaagaccaccaccatctttatggacgccaag gagtcgagcacagtgttcgaactgaagtgcatcgtcgagggcatcatcaagcggcagcca gaggagcagcggctgtacaaggacgaccagctcctcaatgatggaaaaactctgggcgaa tgtggcttcaccagtcagacagcaaggccacagaccccagccacagtgtgcctggccttt cgagcagatgacaccgttgaagcgctgcttattgaacccttctccagccctcggagcttc cagatgtga

DBGET integrated database retrieval system