Rattus norvegicus (rat): 134482489 Help Entry 134482489         CDS       T01003                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism rno  Rattus norvegicus (rat) Pathway rno04066   HIF-1 signaling pathway rno04120   Ubiquitin mediated proteolysis rno05170   Human immunodeficiency virus 1 infection rno05200   Pathways in cancer rno05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     134482489  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     134482489  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     134482489   09162 Cancer: specific types    05211 Renal cell carcinoma     134482489   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     134482489  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rno04121]     134482489    03400 DNA repair and recombination proteins [BR:rno03400]     134482489 Ubiquitin system [BR:rno04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      134482489    Cul5 complex      134482489 DNA repair and recombination proteins [BR:rno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      134482489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  134482489 NCBI-ProteinID:  XP_063132028 LinkDB All DBs Position 16:22414747..22415199 Genome browser AA seq 136 aa AA seqDB search MTASRPRQETSKFLWDQVEFYKNIMDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHA LTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIA PEIALELLMAVNFLDC NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgactgcttctcggcctcgccaggaaactagtaagttcctctgggatcaagtagaattt tataagaacataatggatggagaggagaaaacctatggtggctgtgaaggccctgatgcc atgtatgtgaaattaatatcttctgatggtcatgaatttattgtaaaaagagaacatgca ttaacatcaggaacaataaaggccatgttgagtggtccaggtcagtttgcggagaatgaa accaatgaggtcaactttagagagatcccttcacatgtgctatcgaaagtgtgcatgtat tttacctacaaggtccgctatactaacagctccactgaaattcctgaattcccaattgca cctgaaattgcactggaactgctgatggccgtgaacttcttagattgttaa

DBGET integrated database retrieval system