Rattus norvegicus (rat): 134487077 Help Entry 134487077         CDS       T01003                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism rno  Rattus norvegicus (rat) Pathway rno04060   Cytokine-cytokine receptor interaction rno04151   PI3K-Akt signaling pathway rno04217   Necroptosis rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04623   Cytosolic DNA-sensing pathway rno04630   JAK-STAT signaling pathway rno04650   Natural killer cell mediated cytotoxicity rno04936   Alcoholic liver disease rno05152   Tuberculosis rno05160   Hepatitis C rno05161   Hepatitis B rno05162   Measles rno05163   Human cytomegalovirus infection rno05164   Influenza A rno05165   Human papillomavirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05168   Herpes simplex virus 1 infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05200   Pathways in cancer rno05320   Autoimmune thyroid disease rno05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     134487077    04151 PI3K-Akt signaling pathway     134487077   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     134487077  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     134487077  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     134487077    04621 NOD-like receptor signaling pathway     134487077    04622 RIG-I-like receptor signaling pathway     134487077    04623 Cytosolic DNA-sensing pathway     134487077    04650 Natural killer cell mediated cytotoxicity     134487077  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     134487077   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     134487077    05161 Hepatitis B     134487077    05160 Hepatitis C     134487077    05171 Coronavirus disease - COVID-19     134487077    05164 Influenza A     134487077    05162 Measles     134487077    05168 Herpes simplex virus 1 infection     134487077    05163 Human cytomegalovirus infection     134487077    05167 Kaposi sarcoma-associated herpesvirus infection     134487077    05169 Epstein-Barr virus infection     134487077    05165 Human papillomavirus infection     134487077   09171 Infectious disease: bacterial    05152 Tuberculosis     134487077   09163 Immune disease    05320 Autoimmune thyroid disease     134487077   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     134487077   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     134487077  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rno04052]     134487077 Cytokines and neuropeptides [BR:rno04052]  Cytokines   Interferons    134487077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  134487077 NCBI-ProteinID:  XP_063144748 LinkDB All DBs Position 5:complement(108303567..108304575) Genome browser AA seq 192 aa AA seqDB search MARLCAFLMSLVVVSYWSACCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRKDFG FPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDASLLDSFCNDLQQQLSGLQ ACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN LLGRLREERNES NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggctcggctctgtgctttcttgatgtccctggtggtggtgagctactggtcagcctgc tgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagccttcacactc ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaaggactttggg ttccctttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtcctg catgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgcttgg gatgcatccctgctagactcattctgcaatgacctccagcagcagctgagtggtctgcaa gcctgtctgatgcagcaggtaggggtgcaggaatctcccctgacccaggaagactcccta ctggctgtgagggaatacttccacaggatcactgtgtacctgagagagaagaaacacagc ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac ttgctgggaagactgagagaagaaagaaatgagtcctga

DBGET integrated database retrieval system