KEGG   Rattus norvegicus (rat): 170546
Entry
170546            CDS       T01003                                 
Symbol
Ryr3
Name
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04921  Oxytocin signaling pathway
rno04970  Salivary secretion
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    170546 (Ryr3)
   04020 Calcium signaling pathway
    170546 (Ryr3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    170546 (Ryr3)
  09154 Digestive system
   04970 Salivary secretion
    170546 (Ryr3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    170546 (Ryr3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    170546 (Ryr3)
   05012 Parkinson disease
    170546 (Ryr3)
   05020 Prion disease
    170546 (Ryr3)
   05022 Pathways of neurodegeneration - multiple diseases
    170546 (Ryr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    170546 (Ryr3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Ryanodine receptor
   170546 (Ryr3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 Ins145_P3_rec MIR SPRY RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 170546
NCBI-ProteinID: XP_038962734
RGD: 68952
Ensembl: ENSRNOG00000006645
LinkDB
Position
3:complement(99431755..99979125)
AA seq 4868 aa
MAESGEGGEDEIQFLRTEDEVVLQCIANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTVENGGEGAAQGGSHRTLLYGHAILLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSISNGSIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRVFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQALRLRHLTTGHYLALTED
QGLLLQDRGKADTKSTAFSFRASKEIKEKLDSSHKRDMEGMGVPEIKYGDSVCFVQHVAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQQEESQAARIIRNTTALFSQ
FVSGNNRTAAPVALPIEEVLQTLQDLIAYFQPPEEDMQHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIIREENGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDV
LCSLCLCNGVAVRXNQNLICDNLLPEGNLLLQTRLINDVTSIRPNIFLGVAEGSPRYKKW
LLSLIIDQVEPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGT
TQFLSQASFIPCPIDTSQVVLPLHLEKIRDRLAENIHELWGMNKIELGWTFGKVRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADPTVEKVSIDKIRFFRGVERS
YAVKSGKWYFEFEVVTGGDMRVGWARPGARPDIELGADDQAFVFEGKQGQRWHQGSGYFG
RTWLPGDVVGVHLNLDDASMVFTLYGELLITTXGSELAFADYEIENGFVPICSLGLSQIG
RMNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAVWFSKRLPTFVNVPKDHPHIEVVRI
DGXMDSPPCLKVTHKTFGTQNSNANMIYCRLSMPVECHXSFSHSPCLDSEAFQKRKQMQE
ILSHTTTQCYYAIRIFAGQDPSCVWVXWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVH
ESVKRSNCYMVWGGDIVASSQRSSRSNVDLEIGCLLDLAMGMLSFSANGKELGTCYQVEP
NTKVFPAVFXQPTSTSLFQFELXKLKNAMPLSAAIFKSEEKNPIPQCPPRLDVQTIQPVL
WSRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMQFHY
HTLRLYSAVCALGNSRVASALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLANAK
ERKLMMKNEYIIPITSSTRNIRLYPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTNEDH
QKQSPEIPLQILKTKALSMLTEAVHCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFD
DDDVRQILLLIDPSVFGEHSGETEEGVEKEVTHVEEKAVEAGEKASKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTREFRSPPQEQINMLLNFHLGENCPCPEEIREELYDFHEDLLVHCGVPLEEEEEEEED
TSWTGKLCALVYKIKGQPKPEKEPPTEEEEPYPTTLKELVSQTMIRWAQENQIQDAELVR
MMFNLLRRQYDSIGELLQALRKTYTISQASVNDTINLLAALGQIRSLLSVRMGREEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISESPALDLPSQGYKTEVTQDDEEEEEIVHM
GNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPS
LNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDT
VSLSTTEAALALNRYLCSAVLPLLTRCAPLFSGTEHCTSLIDSTLQTIYRLSKGRSLTKA
QRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLSEYCKMPLKLLTNHYEQCWKYYCLP
SGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDTR
ITATLEKQVSVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSHSGWKYG
ISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQREN
EKLRCVSQSNQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGG
SHPLLVPYDTLTAKEKLRDREKAQDLFKFLQVNGILVSRGVKDMELDASSMEKRFAYKFL
RKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSS
PLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTV
MKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPIL
TSIFEHIAQHQFGVDLLLSDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAA
IPVAFLEPSLNRYNPLSVFNTKTPRERSILGMPDKVEDMCPDVPQLEGLMKEINGLAESG
ARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSIGPCCTKVTSEHLSLILGNILKIIN
NNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKIVQEEEQLKTDGK
GDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDTDSDQLFRMVAEVFIL
WCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYS
IQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSCRDTDEEVKEHLRNNLHLQEKSD
DPAVKWQLNLYKDVLRNEEPSNPEKTVERVQRISAALFHLEQVEQPLRSKKAVWHKLLSK
QRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEAYSFEEKLVQDLAKSPRVEDE
EEEETEKQPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEEEDKE
KTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNA
GVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRER
GEKVLQNDEFTQDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESI
SDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVV
GFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVE
SSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISRKEFQKAMEGLKQYTQSEIDF
LLSCTEADENDMFNYVDFVERFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESV
LNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEK
MELFVNFCEDTIFEMQLASQISESDSTDRPEEEEEEDEDSYSVEIEGEEEDKSFESASAF
AMACASAKRNVTKFLKKATLKNLRKQYRNVKKMSAKELVRVLSSFFWMLVVGLFQLLFSI
LGGIFHILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDVMEIDRAEVTEPGITT
ELVHFVKGEAGDTDVMSDLFGIHSKKEGGSKQGPEVGLGDLSEITGKDEPPTLESTVRKK
RKAQAAEMKAVHEAEGRTESEKADMEDREKEDKIKEEGQAEYLWADTTVKKTRRRGQKAE
KPVAFMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEET
EDVANLWNSFNEDDEEEAMVFFVLQESTGYMAPTLRALAIVHTVISLVCVVGYYCLKVPL
VVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKY
GDLYGAERIAELLGLDKNALDFSPVEEAKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSF
LYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVY
LYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPY
EMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFD
TTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFR
KQYEDQLG
NT seq 14607 nt   +upstreamnt  +downstreamnt
atggctgaatcgggagaaggaggcgaggatgagatccagttcctgcggactgaggatgag
gttgtactccagtgcatcgcaaacattcacaaggagcagcggaagttctgcctggcagct
gagggacttgggaatcgcctgtgcttcttggaacctacctcagaagcaaagtacattcct
ccagatctctgtgtctgcaatttcgtgctggaacagtccttatctgtcagagcactgcaa
gaaatgcttgccaacaccgttgaaaatggtggagaaggggcagcacaaggcggtagccac
aggaccctgctctacgggcatgcaattctcctgcggcactccttcagtggaatgtatcta
acgtgcttgaccacgtcaagatcccagacggataaacttgcctttgatgtaggtctgcgg
gaacatgccacaggagaagcctgttggtggaccatacatcctgcttcgaaacaaaggtct
gaaggagagaaagtacgaattggtgatgaccttatccttgtcagtgtgtcctccgaaaga
tatctccatctctcaatctcaaatggtagcatccaagtggatgcctcctttatgcaaaca
ctctggaatgtacatcctacatgttcaggaagtagcatcgaagaaggatacctactcggt
ggccacgtagttcgacttttccacggtcatgatgaatgtttgacgataccatctacggat
cagaatgactctcagcacaggagggtgttctatgaagctggaggagctgggaccagagcc
aggtctctatggagagtggaaccccttcggataagctggagtggcagtaacatcaggtgg
ggccaggctctccgactccggcatctcaccacaggccactacctggccttgaccgaagac
caaggccttcttcttcaagaccgtggaaaagccgacaccaagtccacagccttctccttc
cgagcatcaaaggaaatcaaggagaaactagattccagtcacaaaagagatatggaaggc
atgggagttccagaaatcaagtatggggattctgtctgctttgttcagcatgtagccagt
ggcctctgggtcacctacaaagcacaagatgccaagacttcccgcctgggacctctgaaa
aggaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagcgatgc
cagcaggaagagtcccaggctgctcgcatcatccggaacaccacagccttattcagccag
tttgtcagtggaaacaatcgcacagctgcccctgtggccttgccaatagaagaggtccta
cagaccctacaagacttgatagcctacttccaaccaccagaggaggacatgcaacatgaa
gacaaacagaataagctccgctctctaaaaaacagacagaatcttttcaaggaagagggg
atgctggcccttgtattgaactgcatcgatcgattaaacatctacaacagtgtagcacac
tttgcagggatcatcagggaagagaacggcatggcctggaaagagattctgaacctgcta
tacaaattactagctgctctcattcgtggaaacagaaacaactgtgctcaattctccaat
aaccttgattggttaattagtaagttggacagattagaatcttcctcaggtatcttggag
gtcttgcactgcatcttgattgaaagcccagaagccttaaacctaatagcagagggccac
atcaagtccatcatctccctactggataagcacgggcggaatcacaaggttcttgatgtc
ctgtgctccctctgtctctgcaatggggttgcagtaagangcaaccagaatctgatctgt
gacaacctactacccgaaggaaacctgcttctgcagacacggctaattaatgatgtcacc
agtatccgaccaaacatcttcctgggagttgctgaaggttcccccaggtacaagaagtgg
ttattgagtttaattatcgaccaagtggagcctttcctaacagcagagcccactcatctg
cgggtgggctgggcctcctcttcaggctatgccccataccctggaggtggagaaggatgg
ggaggcaacggtgttggtgatgacctgtactcctatggctttgatgggcttcatctctgg
tcaggccggatacccagagctgtggcctccatcaaccagcatctgctgaagtcagatgat
gtggtgagctgctgccttgaccttggagtacccagcatttctttccgaatcaatggacaa
cctgtgcagggaatgtttgagaatttcaacacagatggactctttttccccgtgatgagt
ttttcggctggtgtcaaagtacgcttcctgatgggtggtcggcatggggaatttaagttc
ctgcctccttctggctatgccccttgctatgaagccttacttccgaaggagaagatgaga
ttggagcctgtcaaagaatataagcgtgatgctgatggtgttagagatctgttgggtacc
actcagtttctctcccaagcctctttcatcccatgtcccatagataccagtcaggttgtt
ttgccacttcacctagagaagatcagagacagactggccgagaatatccatgagctttgg
ggaatgaataaaatagaactcggctggacttttggcaaagtgcgggatgacaacaaaaga
caacatccctgccttgtggagttttcaaagctccctgaaactgagaagaattataacctg
cagatgtcaactgaaaccttgaaaaccttgctggctctgggctgccacattgctcatgtt
aacccagctgcagaagaggatctaaagaaagtgaaactgcccaaaaactatatgatgtcc
aatggctataagccagcccctttggatttatctgatgtgaagctattaccacctcaagaa
attttagtagataagcttgcagaaaatgcacacaatgtttgggcaaaggacagaataaaa
caaggatggacctacggcattcaacaggatttgaagaataaaagaaatccccgcctggtg
ccatatgcgttactagatgagcgaaccaagaaatcaaacagggacagcctacgggaagct
gtacggacatttgttggttatggatataacattgaaccatcagaccaagaactagctgac
cctactgtcgagaaggtcagcatagacaagatccgatttttccggggggtagagcggtca
tatgcagtaaaatctggaaagtggtactttgaattcgaagtagtaacaggaggagacatg
cgcgttggctgggccaggccaggcgctcgtcctgacattgagctcggagctgacgaccaa
gccttcgtgtttgaaggcaagcagggtcagcgttggcaccaaggcagtgggtattttgga
cgaacttggctgccaggagatgtggtcggggtgcatttaaacctggacgacgcctctatg
gtcttcacactgtatggggagctgctcatcaccacataaggctctgaacttgccttcgca
gactatgagatcgagaacggttttgtgcccatttgctctctggggctgtcccagattggc
cgcatgaatcttgggacagatgccagtaccttcaagttttataccatgtgtggactccag
gagggctttgagccttttgcggtaaatatgaaccgagatgttgctgtgtggtttagcaag
cgcctcccaacatttgtgaatgtgcccaaggatcatccccacatagaggttgtgagaatt
gatggcnacatggacagtcctccatgcctcaaggtgacccacaagaccttcggcacacag
aacagcaatgccaacatgatctactgccgcctgagcatgcccgttgaatgccatncttca
ttcagccacagtccctgcctagacagtgaagccttccaaaaaaggaaacagatgcaagaa
atactctctcacacaacaacacaatgctactatgctatccgcatttttgctgggcaggac
ccatcatgtgtctgggttngatgggtgactccagactaccatttatacagtgaaaagttt
gacctgaataaaaactgcaccgtgactgtcaccctgggagatgaaaggggccgggttcat
gaaagtgtgaaacgtagcaactgctatatggtctggggtggggacattgtagccagttcc
cagagatcaagccggagcaatgtggacctggagattggctgccttctagatctggcaatg
ggcatgttgtccttctctgcgaatgggaaggaacttggcacctgctaccaggtggagcct
aacaccaaagtattcccagcagtcttcnctcagcctaccagcacctccttgtttcagttt
gaacttngaaaactgaagaatgcaatgcctctgtcagcagccatatttaagagtgaagag
aagaaccccatcccacagtgcccacctaggctggatgtccaaaccatccagcctgtgctc
tggagccgcatgcccagcagcttcctcaaagtggagaccgagcgagtgagcgagcgccac
ggctgggtggtgcagtgcctagaacccctgcaaatgatggcactccacatccctgaggag
aacaggtgtgtggacatcctcgagctctgtgagcaggaggacctgatgcagttccattac
cacacactgagactttacagcgctgtgtgcgctctgggaaatagccgagttgcttctgcc
ctgtgcagccatgtggacctctcacagctcttctatgccattgacaacaagtacctgcct
ggcctcctccgatctggtttctatgacctgcttattagcatccacctggccaatgctaag
gagaggaagctgatgatgaagaatgagtacatcatccctatcaccagcagtaccaggaat
atccgcctatacccagatgagtccaagaggcatggtttgcctggggtgggcctgaggaca
tgcctcaagccaggcttcaggttctctaccccttgctttgtggtgactaatgaggaccat
cagaaacagagccctgagattcccttgcagattctcaagacaaaggccctgagcatgctg
accgaggcggtacattgtagtggggcccacatcagagaccctgttgggggttctgtggag
ttccagtttgtgcctgtgctgaaactcattgggaccttgttagtcatgggagtttttgac
gacgatgatgttcgccagattctcctcctgatagatccctctgtgtttggggagcacagt
ggtgagacagaagagggagtggagaaagaagtgacccacgtagaggaaaaggcggtggag
gctggagaaaaggctagcaaggaggctccagtcaaaggcttgctgcagacccgattacct
gagtctgtcaagctgcagatgtgcgaactcctcagctacctctgtgactgtgaactacag
caccgagtagaggctattgtggcatttggtgacatttacgtgtccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaatatgtctgcagccctaactgcc
cggaagacaagagagttccgctcaccaccccaggagcagatcaacatgctcctcaacttt
cacctgggagagaactgcccctgcccagaggagatccgagaggagctgtacgacttccat
gaggaccttctggttcactgtggggtccccttggaggaagaggaggaagaggaggaggac
acttcatggacaggaaaactgtgtgctctggtgtataaaatcaaggggcaacccaagcct
gagaaggagccaccaacagaggaagaggaaccgtaccctacaacactgaaggaactagtc
tcacagacaatgatccgttgggcccaggagaaccaaatccaggatgcagagctggtgagg
atgatgttcaacctcctccggagacagtatgacagcatcggggagttgctacaggctctg
cggaagacctacaccatcagccaggcctctgtgaacgacaccatcaacctgctggctgcc
ctgggccagattcggtccctgcttagtgtcaggatggggagagaagaggagctcctcatg
atcaacgggctaggggacataatgaacaacaaggtgttttaccagcatcccaaccttatg
agagtcctcggcatgcatgagacagtgatggaagtgatggtgaatgtgttgggtacagaa
aagtcacagattgccttcccaaagatggttgctagctgctgccgcttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttacctgctggag
aacagtagtgtgggcctagcatccccatcaatgagggggtccaccccactggatgtggca
gcctcctctgtgatggacaataacgaattagcactgggcttagaagaaccggatcttgag
aaggttgtaacctacttggcaggttgtggtcttcagagctgccccatgcttctggccaaa
ggataccctgacatcggttggaaccccattgaaggagagcgttacctgtccttcctgagg
tttgccgtcttcgtgaacagtgaaagtgtggaggaaaatgccagtgttgtggtcaagttg
ctcatcagacgtcccgagtgctttggtccagctctgaggggtgaaggagggaacggactg
ctggcagctatgcagggtgccattaagatctcagagagccctgccctcgaccttccttcc
cagggttacaagacggaagtcacacaggacgatgaagaggaggaagagattgtgcacatg
ggcaatgcaattatgtcattttattcagcgcttatcgatctattaggccgatgtgctcct
gaaatgcatctcatccaaacaggcaaaggggaagccatccggatccggtccatcctgcgc
tccctggtccccacagaagacctggttggaatcatcagcattcccctgaagctgccctcc
ctaaacaaagatgggtccgtcagcgagccagacatggcggccaacttctgtcctgaccac
aaagcacccatggtgctgttcttggaccgtgtttatggcattaaagatcaaacttttctg
ctccacttgctggaagttgggtttttacccgatttacgagcttctgcatctctagataca
gtgtccctcagcaccacagaggccgcgctggcactgaataggtatttatgttcggctgtg
ctcccgctccttactagatgcgcccctctcttttctgggacagagcactgtacttctctg
atcgactctacactgcagacaatatacagactttccaaaggacggtccctcaccaaggca
cagagggacaccatagaagaatgtttgctagccatttgcaatcacttgagaccttccatg
ttacagcaactcctgcggcgtctggtctttgacgtgccacagctcagcgagtactgcaaa
atgccactcaagctcctgacaaatcactatgagcagtgctggaagtattactgcctgcct
tcgggatgggggagctatgggctagcagtggaggaggagctgcacctcacggagaagctc
ttctgggggatttttgactccctctcgcacaagaaatacgacccggaccttttccgaatg
gccctgccttgtctcagtgctattgctggagccttgccaccggactatttagatactaga
atcacggccacactggagaagcaggtctcagtggatgcagatggaaactttgaccccaaa
cctatcaacaccatgaatttttccttgcctgaaaaattggaatacattgtcaccaagtac
gctgagcattctcatgataaatgggcttgcgacaagagtcacagtggatggaaatatggg
atttctctggatgaaaatgtgaagacccacccactaatacggcctttcaagaccttaaca
gagaaggagaaggaaatttatcgctggcctgccagagagtccctgaaaaccatgctggct
gtgggctggacagtggaaaggaccaaagaaggagaagctttggttcaacaaagagagaat
gagaagcttcgatgtgtgtcccagtccaatcagggcaacagctacagccctgcccctctg
gatctctcaaatgttgtgctgtccagggagcttcagggaatggtggaggtggtggctgaa
aactatcacaatatctgggccaagaagaagaagctggagctggaaagcaaaggtggtggc
agtcaccctcttttggtaccatatgacaccttgactgccaaggaaaagctcagggatcga
gaaaaggcacaggacctgttcaaattcctccaggtgaatggcattctagtttctagaggc
gtgaaggacatggagctggatgcctcctccatggaaaagagatttgcctacaagtttttg
aggaagatcctgaagtacgttgactctgctcaagagtttattgcccacttggaagccatt
gtcagcagtgggaaaacggaaaagtctccccatgaccaggagatcaaattctttgccaaa
gttctcctcccactggttgaccagtacttcaccaaccaccgcctttatttcctgtcatct
cctttgaagccgcttagcagcagtgggtatgcttcccataaagagaaagaaatggtggcc
agcctattctgcaagctggccgctcttgtgagacacaggatttccctctttgggagtgat
tcaactacaatggtgagctgtcttcatatcttagctcagacacttgacacaaggacagtg
atgaagtcaggctcagagctggtgaaagccgggctgcgagcgttctttgaaaatgctgcg
gaagaccttgagaagacctcagaaaacctgaagctggggaagtttacccattccagaacg
cagatcaaaggtgtttctcagaatattaactacaccacagtggctctgcttcccatcctg
acatccatctttgagcacatcgctcagcatcagtttggggtggatctactcttgagtgac
gtgcagatttcatgctaccacattctgtgcagcctctattcccttgggactgggaaaaat
atctatgttgaaaggcaacgtcctgctcttggagaatgtctggcttccctagcagctgct
atccctgtggcatttctggaacccagccttaaccgctataatcccctctcagtcttcaac
accaaaacacccagggagcggtctattctggggatgccagacaaggtggaggacatgtgt
cctgacgtcccgcagctggaaggcctgatgaaggaaatcaatggcttggccgagtcaggt
gcccggtataccgagatgccccatgtcattgaagtgatcttgcccatgctctgcaactac
ctgtcctactggtgggagcggggacctgagaacctgcccccaagcataggaccctgctgc
accaaggtcacatctgaacacctcagcctcatcctgggcaacatactgaaaatcatcaac
aacaacctgggcattgatgaggcctcctggatgaagcgtatcgcagtgtatgcccagcca
atcatcagcaaagccaggcctgacctgcttcgaagccacttcatccccaccctggagaag
ctgaagaagaaggcggtgaagattgtgcaggaggaggagcagctgaagactgatggcaag
ggggatacccaggaggctgagctcctcatcctagacgagtttgctgtcctctgcagggac
ctgtatgccttctaccccatgctgatccgctatgtggacaacaacagatctaactggctc
aaaagcccggatactgattctgaccagctcttccgaatggtggccgaggtcttcattctg
tggtgtaaatctcacaacttcaagagggaagagcaaaatttcgtgattcaaaatgaaatt
aataacttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaagta
aagtctggaggacaggaccaggaacggaagaagacaaagaggcgaggagacttgtattcc
atccagacgtccctcatcgtggctgcactcaagaaaatgctgcccattggtctgaacatg
tgtactccaggcgaccaggagctcatctcgcttgcgaaatcacgatacagctgtagagac
actgatgaagaagtcaaggaacatcttcggaataacctgcacctgcaggagaagtctgat
gaccccgctgtgaaatggcaactgaacctctacaaagacgttctgaggaatgaagagcct
tctaatccagaaaagacggtggagcgggtgcagaggatttcagcggctctgttccacctg
gagcaggtggaacagcctttgaggtccaaaaaggctgtgtggcataaattgttgtcaaag
caacggaaacgggcagtggtggcctgtttcaggatggctccactctacaatctgcccagg
caccgctctattaacctcttcctccatggctatcagagattttggatagaaacagaggcg
tattcctttgaagagaaactagtacaggatttggctaaatctcccagggttgaagatgag
gaagaagaggagaccgaaaagcaacctgacccccttcaccagatcattctacattttagc
cgcaatgcgctcactgagaggagcaaattggaagatgacccactgtacacttcctattcc
agcatgatggccaagagctgtcagagtggtgaggatgaagaagaagaggaagacaaggaa
aaaacattcgaagagaaggagatggagaagcaaaagacactatatcagcaagcacgacta
cacgagcgtggtgctgcagagatggtccttcagatgataagtgccagcaaaggtgagatg
agccccatggtggttgagaccctgaagctggggattgccattctgaacggaggcaatgct
ggtgtgcaacagaaaatgctagattacttaaaggagaaaaaagatgctggattctttcaa
agcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagaggcag
aataaagctgaaggcctggggatggttacagaagaaggcaccctcattgtccgtgagcgt
ggtgaaaaggtactccagaatgatgaattcacacaagatctctttagatttctacagttg
ctttgtgaaggacataacagtgactttcagaacttcctgagaactcagatgggcaacacc
actactgtgaacatcattattagcaccgtggactaccttctgcgtctgcaggagtcaatc
agcgatttctattggtactattcaggaaaggacatcattgatgaatctggacagcacaat
ttctctaaagctctggcagtcaccaagcaaatctttaattctcttacagagtacatccag
ggcccttgcatcgggaaccagcagagcctggctcacagtaggctgtgggatgcagtggtt
ggattcctccatgtatttgctaacatgcagatgaagctctctcaggattccagtcagatc
gagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctc
ctggaaggaaatgtggtaaatgggactattggaaagcagatggttgacacgctggtagaa
tcgtctactaatgtagagatgatcttgaaattctttgacatgttcttgaaacttaaagac
ttaaccagctcagacaccttcaaagaatatgacccagatggtaaagggatcatctcccga
aaagaattccagaaggccatggaaggtctaaagcaatatacacagtcagagattgatttt
cttctttcgtgtacagaggctgatgagaatgacatgtttaattatgtggattttgtagag
aggttccacgagccagccaaggacatagggttcaatgtggcggtgttattgacaaatctc
tctgagcatatgccaaatgattctcgtctcaagtgtctcttggacccagcagaaagtgtg
ctaaattactttgaaccatacctgggtcgaatcgagatcatgggtggggccaagaagatt
gagcgtgtttattttgagatcagtgaatccagtcgaactcagtgggaaaagcctcaagtg
aaggaatctaagcgacagttcatctttgatgttgtcaatgaaggcggggagcaagagaag
atggaactgtttgtgaacttctgtgaagatacaatattcgagatgcaattagcatctcag
atctcagaatctgactcaactgacaggccagaagaggaagaggaagaggatgaagattcc
tattcggtagaaattgagggggaggaagaagataaatcttttgagtctgcctctgcattt
gccatggcctgtgcctcagcaaagagaaatgtcaccaagtttctgaagaaggcaaccttg
aagaacctcaggaaacagtacaggaatgtgaaaaagatgagcgcaaaggagctggtcagg
gtgctctcctccttcttctggatgctggttgtgggcctctttcagttgctcttctctatc
ttgggaggaatctttcacatactctggaacacagtatttggagggggccttgtagaaggg
gcaaagaacatcagagtgactaagatcctaggtgacatgcccgaccccacccagtttggg
atccatgatgatgtaatggagattgacagggcggaagtgactgagccaggtatcaccacc
gagctggtccactttgtaaagggtgaggccggagacacagacgtcatgtcagacctcttt
ggaatccactcaaagaaagaaggtggttcaaagcaagggcctgaagtgggattaggtgac
ctctctgaaattaccggcaaagacgaacccccgacattagagagtactgtacggaagaaa
aggaaagcacaggcagcagagatgaaggcagtgcatgaagctgaaggaagaactgaatct
gagaaggccgacatggaagacagagaaaaggaagacaaaatcaaggaggagggacaagca
gagtacctgtgggcagacacaacagtaaagaagacgcgacggcgtggtcagaaggccgag
aagccagtagccttcatggccaacttcttcaaagggctggagatttatcagaccaagtta
ctgcactacctggccaggaatttctacaacctgaggttcctcgctctatttgtagccttc
gctatcaacttcatcctgcttttctataaggtcacggaagagcctttagaggaagaaaca
gaggatgttgcaaacctgtggaactcattcaatgaggatgatgaggaagaagcgatggtg
ttctttgttcttcaggagagcactgggtatatggcaccaacactgcgtgccctggccatt
gtccacactgtcatctctctggtctgtgtggtgggctattactgcctgaaggtacctttg
gtggtattcaaaagggagaaggaaattgccaggaagctggagtttgatggtctgtatatc
actgagcagccatctgaggatgacatcaaagggcagtgggatcgcttggtgatcaacacg
ccatcttttcctaataactactgggacaagtttgtgaagagaaaggtgatcaacaagtat
ggagatctctatggagcagagcgcatcgctgaactcctgggtttggacaaaaatgccctg
gactttagcccagtagaagaggccaaagcagaggcggcgtctctggtgtcatggctaagt
tccatcgacatgaagtaccatatttggaagctaggggtggttttcactgacaactccttt
ctctaccttgcctggtacacaaccatgtctgtcctgggccactacaacaacttcttcttt
gctgctcatctgttggatattgccatgggctttaagaccttgaggacgatcctgtcatct
gtgactcacaatggcaaacagctggttctgactgttggcctcctggctgtagttgtttac
ctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagcgaagatgat
gatgagccggatatgaagtgtgatgacatgatgacgtgctacctcttccacatgtatgtg
ggcgtaagagcaggtggcggcattggtgacgaaattgaagatcccgctggtgacccttat
gaaatgtatcgcatcgtctttgatattaccttcttcttctttgtcattgtcatcttgctg
gccatcattcaaggtcttattattgatgcttttggagagctgagggaccagcaggaacaa
gtacgggaagacatggagactaaatgcttcatctgtggcattggcaatgactactttgac
acgacccctcatggttttgaaacgcatacattgcaagagcacaacttagccaattatcta
ttcttccttatgtatttgattaacaaggatgaaacagaacacacgggtcaggaatcctat
gtgtggaagatgtaccaggaaaggtgttgggacttcttcccagctggagactgcttccgt
aagcaatatgaagatcagctcgggtaa

DBGET integrated database retrieval system