KEGG   Rattus norvegicus (rat): 171091
Entry
171091            CDS       T01003                                 
Symbol
Zbp1
Name
(RefSeq) Z-DNA-binding protein 1
  KO
K12965  Z-DNA binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    171091 (Zbp1)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    171091 (Zbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171091 (Zbp1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     171091 (Zbp1)
   mRNA cycle factors
    Stress granule specific factors
     171091 (Zbp1)
SSDB
Motif
Pfam: z-alpha RHIM DprA_WH DUF5805 PheRS_DBD1 Rrf2 TFIIE_alpha HTH_11 GntR
Other DBs
NCBI-GeneID: 171091
NCBI-ProteinID: NP_598248
RGD: 619956
Ensembl: ENSRNOG00000006314
UniProt: A0A0G2JZL0 G3V6S4
LinkDB
Position
3:complement(161993351..162009297)
AA seq 409 aa
MAEASVDLGTGDNLEQKILQVLSDAGSPVQIDQLLKKLQVPKKILNQVLYRLKKEGRVSS
PAPATWSLGGDGASGDGAPEIPEDSAAQPSLEERILRFLETKGPQRALHIAKALGMTTAK
EVNPILYSMRNKHLLTVSDTQMWTIYRSSQEGQERACSGVGQESPAVIYQQNPINMICQQ
GPNSLISISNSKAIQIGHGNVMSRQTICGDPGPGTPHHAPLPVLEDAAAQDTPPGTHGAQ
LIHLNKSMLRRVQLGHGNEMNLERDPVEHPIFSFSSSPPESTTTADPETAFNMQTPEPGP
HPEGGTTQIVHIKSCLLEDTTVGNNNKMTIHRRSKGGAKESADSQELKEDTGASSEATPP
RSCLHTPSDSTLLTSELTAMALGDGSPQITESMLREDEVQAAETCQTQD
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcggaggcttctgtggacctgggcacgggagacaacctggagcagaagatcctgcag
gtgttgagtgatgctggtagtcctgtgcagatcgaccagctgttgaagaagttacaagtg
cccaagaaaatcctcaaccaagtcctttaccgcctgaagaaagagggccgagtgtcctcg
ccggcgccagcgacgtggtccttaggtggagatggggcttccggagatggggctcccgag
atccctgaggactccgctgcccagcctagccttgaagaaaggatattaagattcctggag
actaaagggccccagagggccctgcatatcgccaaggctctgggaatgacgacggccaaa
gaagtgaaccccatcctgtattccatgaggaataagcaccttctgaccgtgtctgacaca
cagatgtggaccatctaccgctcaagccaggaaggccaagagcgagcttgttccggagtc
ggacaagagtcccctgcggttatttaccagcaaaatccgatcaacatgatctgccaacaa
ggacccaacagcctcatctctatttccaactcaaaagccatccagattggccatgggaat
gttatgtcaagacagacaatctgtggtgacccaggtcccgggactcctcaccacgcccct
ctacccgtgctagaggatgctgctgctcaggacacgccccctggtacccacggagctcaa
ctcatccacctgaacaagtccatgctccgacgtgtgcagctcggccacggcaacgagatg
aacctcgagagggatccagtggaacaccccattttcagctttagtagtagccccccagag
tcaaccaccactgcagacccagaaactgcattcaacatgcaaacacctgagccaggccct
caccctgagggaggcacaacccagatagtccacatcaaatcctgcttgctagaggacacg
accgtcggcaacaacaacaagatgaccatccaccgtaggtcaaagggtggagccaaggag
tctgcagacagccaagaactgaaagaagacacaggtgcaagttctgaagccacgccaccc
agaagctgcttgcacacacccagcgactccaccctgctcacctctgagctgacagctatg
gctctgggagatggcagcccccagatcacagaatctatgcttagagaggatgaagtgcag
gccgcagaaacctgtcagacgcaggactga

DBGET integrated database retrieval system