Rattus norvegicus (rat): 24516 Help Entry 24516             CDS       T01003                                  Symbol Jun Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04010   MAPK signaling pathway rno04012   ErbB signaling pathway rno04024   cAMP signaling pathway rno04137   Mitophagy - animal rno04210   Apoptosis rno04310   Wnt signaling pathway rno04380   Osteoclast differentiation rno04510   Focal adhesion rno04530   Tight junction rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04625   C-type lectin receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04662   B cell receptor signaling pathway rno04668   TNF signaling pathway rno04722   Neurotrophin signaling pathway rno04912   GnRH signaling pathway rno04915   Estrogen signaling pathway rno04921   Oxytocin signaling pathway rno04926   Relaxin signaling pathway rno04932   Non-alcoholic fatty liver disease rno04933   AGE-RAGE signaling pathway in diabetic complications rno05030   Cocaine addiction rno05031   Amphetamine addiction rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05140   Leishmaniasis rno05142   Chagas disease rno05161   Hepatitis B rno05162   Measles rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05200   Pathways in cancer rno05203   Viral carcinogenesis rno05207   Chemical carcinogenesis - receptor activation rno05208   Chemical carcinogenesis - reactive oxygen species rno05210   Colorectal cancer rno05211   Renal cell carcinoma rno05224   Breast cancer rno05231   Choline metabolism in cancer rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05321   Inflammatory bowel disease rno05323   Rheumatoid arthritis rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     24516 (Jun)    04012 ErbB signaling pathway     24516 (Jun)    04310 Wnt signaling pathway     24516 (Jun)    04668 TNF signaling pathway     24516 (Jun)    04024 cAMP signaling pathway     24516 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     24516 (Jun)   09143 Cell growth and death    04210 Apoptosis     24516 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     24516 (Jun)    04530 Tight junction     24516 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     24516 (Jun)    04621 NOD-like receptor signaling pathway     24516 (Jun)    04625 C-type lectin receptor signaling pathway     24516 (Jun)    04660 T cell receptor signaling pathway     24516 (Jun)    04658 Th1 and Th2 cell differentiation     24516 (Jun)    04659 Th17 cell differentiation     24516 (Jun)    04657 IL-17 signaling pathway     24516 (Jun)    04662 B cell receptor signaling pathway     24516 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     24516 (Jun)    04915 Estrogen signaling pathway     24516 (Jun)    04921 Oxytocin signaling pathway     24516 (Jun)    04926 Relaxin signaling pathway     24516 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     24516 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     24516 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     24516 (Jun)    05207 Chemical carcinogenesis - receptor activation     24516 (Jun)    05208 Chemical carcinogenesis - reactive oxygen species     24516 (Jun)    05203 Viral carcinogenesis     24516 (Jun)    05231 Choline metabolism in cancer     24516 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     24516 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     24516 (Jun)    05211 Renal cell carcinoma     24516 (Jun)    05224 Breast cancer     24516 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     24516 (Jun)    05170 Human immunodeficiency virus 1 infection     24516 (Jun)    05161 Hepatitis B     24516 (Jun)    05171 Coronavirus disease - COVID-19     24516 (Jun)    05162 Measles     24516 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     24516 (Jun)    05169 Epstein-Barr virus infection     24516 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     24516 (Jun)    05135 Yersinia infection     24516 (Jun)    05133 Pertussis     24516 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     24516 (Jun)    05142 Chagas disease     24516 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     24516 (Jun)    05321 Inflammatory bowel disease     24516 (Jun)   09165 Substance dependence    05030 Cocaine addiction     24516 (Jun)    05031 Amphetamine addiction     24516 (Jun)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     24516 (Jun)    05418 Fluid shear stress and atherosclerosis     24516 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     24516 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     24516 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     24516 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:rno03000]     24516 (Jun) Transcription factors [BR:rno03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     24516 (Jun) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha TFIIA DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  24516 NCBI-ProteinID:  NP_068607 RGD:  2943 Ensembl:  ENSRNOG00000026293 UniProt:  P17325 A6JRH4 LinkDB All DBs Position 5:complement(115009900..115012993) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagtggcgcctacggctacagtaaccctaagattctgaagcagagcatgaccttg aacctggccgacccggtgggcaatctgaagccgcacctccgagccaagaactcggacctt ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgccggagctggagcgcctgatc atccagtccagcaatgggcacatcaccactacaccgacccccactcagttcttgtgcccc aagaacgtgaccgacgagcaggagggcttcgccgaaggcttcgtgcgcgccctagctgaa ctgcatagccagaatacgctgcccagtgtcacctccgcggcacaacctgtcagtggggcg ggcatggtcgctcccgctgtggcctcagtagctggcgctggcggcggcggcggctacagc gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg ctgagcagcggcggtggggcgccctcctatggcgcgaccgggctggcctttccatcgcag ccccagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg cagcacccgcggctgcaggcgctgaaggaagagccgcagacggtgccggagatgccggga gagacgccgcccttgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagcggatc gcccggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system