Rattus norvegicus (rat): 24584 Help Entry 24584             CDS       T01003                                  Symbol Myl11 Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism rno  Rattus norvegicus (rat) Pathway rno04510   Focal adhesion rno04520   Adherens junction rno04670   Leukocyte transendothelial migration rno04810   Regulation of actin cytoskeleton rno04814   Motor proteins rno04820   Cytoskeleton in muscle cells rno05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rno00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     24584 (Myl11)    04520 Adherens junction     24584 (Myl11)   09142 Cell motility    04814 Motor proteins     24584 (Myl11)    04820 Cytoskeleton in muscle cells     24584 (Myl11)    04810 Regulation of actin cytoskeleton     24584 (Myl11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     24584 (Myl11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     24584 (Myl11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:rno04812]     24584 (Myl11)    04147 Exosome [BR:rno04147]     24584 (Myl11) Cytoskeleton proteins [BR:rno04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      24584 (Myl11) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of hepatic cells    24584 (Myl11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  24584 NCBI-ProteinID:  NP_036737 RGD:  3141 Ensembl:  ENSRNOG00000017645 UniProt:  P04466 A6I9M4 LinkDB All DBs Position 1:191257432..191263046 Genome browser AA seq 169 aa AA seqDB search MAPKKAKRRAAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggccaagagaagggcagcagcagaagggagctccaatgttttctcc atgtttgaccagactcagatccaggagttcaaggaggctttcactgtaattgatcagaac agggatggcattattgacaaggaggatcttcgggacacctttgcggccatgggccgtctc aatgtgaagaatgaggaactcgacgccatgatgaaggaagccagtgggcctatcaacttc actgtcttcctgaccatgtttggggagaagctgaagggtgcggaccccgaggatgtgatc actggagccttcaaggtcctggacccagaagggaagggcaccatcaaaaagcaattcttg gaggagctgcttaccacgcagtgcgaccgattttcccaggaggagatcaagaatatgtgg gcagccttccctccagatgtgggcggcaacgtggactacaagaacatctgctatgtcatc acacacggtgacgctaaggaccaggaatag

DBGET integrated database retrieval system