KEGG   Rattus norvegicus (rat): 246253
Entry
246253            CDS       T01003                                 

Gene name
Adipoq
Definition
(RefSeq) adiponectin precursor
  KO
K07296  adiponectin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    246253 (Adipoq)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    246253 (Adipoq)
   03320 PPAR signaling pathway
    246253 (Adipoq)
  09149 Aging
   04211 Longevity regulating pathway
    246253 (Adipoq)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    246253 (Adipoq)
   04932 Non-alcoholic fatty liver disease
    246253 (Adipoq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    246253 (Adipoq)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   246253 (Adipoq)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 246253
NCBI-ProteinID: NP_653345
RGD: 628748
Ensembl: ENSRNOG00000001821
UniProt: Q8K3R4
LinkDB
Position
11
AA seq 244 aa
MLLLQALLFLLILPSHEGITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDG
TPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLE
TRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDK
AVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLY
HDTN
NT seq 735 nt   +upstreamnt  +downstreamnt
atgctactgttgcaagcgctcctgttcctcttaatcctgcccagtcatgaagggattact
gcaaccgaagggccaggagctttggtccctccacccaaggaaacttgtgcaggttggatg
gcaggcatcccaggatatcctggtcacaatgggataccgggccgtgatggcagagatggc
actcctggagagaagggagagaagggagacgcaggtgttcttggtcctaagggtgaccca
ggagatgctggaatgacaggagcggaagggccacggggctttcccggaacccctggcagg
aaaggagagcccggagaagccgcttacatgtatcactcagcattcagcgtagggctggag
acccgcgtcactgtccccaatgttcccattcgctttactaagatcttctacaaccaacag
aatcattatgacggcagcactggcaaattccactgcaacattccggggctctactacttt
tcctaccacatcacggtgtacatgaaggatgtgaaagtgagcctcttcaagaaggacaag
gccgttctcttcacctacgaccagtatcaggaaaaaaatgtggaccaggcctctggctcc
atgctcctccatctggaggtgggagaccaagtctggctccaagtgtatggggaaggggac
aacaatggactctatgcagataatgtcaatgactctacatttacaggcttccttctctac
catgataccaactga

DBGET integrated database retrieval system