KEGG   Rattus norvegicus (rat): 25099
Entry
25099             CDS       T01003                                 

Gene name
Foxa2
Definition
(RefSeq) hepatocyte nuclear factor 3-beta
  KO
K08035  forkhead box protein A2, hepatocyte nuclear factor 3-beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04213  Longevity regulating pathway - multiple species
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    25099 (Foxa2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25099 (Foxa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25099 (Foxa2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    25099 (Foxa2)
SSDB
Motif
Pfam: Forkhead HNF_C Forkhead_N
Other DBs
NCBI-GeneID: 25099
NCBI-ProteinID: NP_036875
RGD: 2808
Ensembl: ENSRNOG00000013133
UniProt: P32182
LinkDB
Position
3
AA seq 459 aa
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML
TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG
NMFENGCYLRRQKRFKCEKQLALKEAAGAGSGGGKKTAPGTQASQVQLGEAAGSASETPA
GTESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLLVPPHHPGLP
PEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKTYEQVMHYPGGYGSPM
PGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgctgggagccgtgaagatggaagggcacgagccatccgactggagcagctactacgcg
gagcctgagggctactcttccgtgagcaacatgaacgccagcctggggatgaatggcatg
aacacttacatgagcatgtccgcggctgcaatgggcagtggttccggcaacatgagcgca
ggctccatgaacatgtcatcctatgtgggcgctggaatgagcccgtcgctggctggcatg
tccccgggcgcgggcgccatggcgggcatgagcggctcagctggggcggccggcgtggcg
ggcatgggaccgcacctgagtccgagtctgagcccactcgggggacaggcggccggggct
atgggtggccttgctccctacgccaatatgaactccatgagtcctatgtacgggcaggcg
ggcctgagccgcgctcgggaccccaagacgtaccggcgcagctacactcacgccaagcct
ccctactcgtacatctcgctcatcaccatggccatccagcagagccccaacaagatgctg
acgctgagcgagatctatcagtggatcatggacctcttccctttctaccggcagaaccag
cagcgctggcagaactccatccgtcattctctctccttcaacgactgctttctcaaggtg
ccccgctcgccagacaagcctggcaagggctccttctggaccctgcaccctgactctggc
aacatgttcgagaacggttgctacctgcgccgccagaagcgcttcaagtgtgagaagcaa
ctggcgttgaaggaagcagcgggtgcgggcagtggcggaggcaagaagaccgctcctggg
acacaggcttctcaggttcagctcggggaggccgcaggctcggcctctgagactccggcg
ggcaccgagtccccccattccagcgcttctccgtgtcaggagcacaagcgaggtggcctg
agcgagctgaagggaacacctgcctctgcgctgagtcctccggagccggcgccctcgcct
gggcagcagcagcaggctgcagcccacctgctggtcccacctcaccatcctggcctgcca
ccagaggcccacctgaagcccgagcaccattacgccttcaaccaccccttctctatcaac
aacctcatgtcctccgagcagcaacatcatcacagccaccaccaccatcagccccacaaa
atggacctcaagacctacgaacaggtcatgcactaccctgggggctacggttcccccatg
ccaggcagcttggccatgggcccagtcacgaacaaagccggcctggatgcctcgcccctg
gctgcagacacttcctactaccagggagtgtactccaggcctattatgaactcgtcctaa

DBGET integrated database retrieval system