Rattus norvegicus (rat): 25298 Help Entry 25298             CDS       T01003                                  Symbol Cck Name (RefSeq) cholecystokinin preproprotein   KO K05226   cholecystokinin Organism rno  Rattus norvegicus (rat) Pathway rno04080   Neuroactive ligand-receptor interaction rno04081   Hormone signaling rno04911   Insulin secretion rno04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     25298 (Cck)    04081 Hormone signaling     25298 (Cck)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     25298 (Cck)   09154 Digestive system    04972 Pancreatic secretion     25298 (Cck)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rno04052]     25298 (Cck) Cytokines and neuropeptides [BR:rno04052]  Neuropeptides   GPCR binding    25298 (Cck) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A Motif Other DBs NCBI-GeneID:  25298 NCBI-ProteinID:  NP_036961 RGD:  2288 Ensembl:  ENSRNOG00000019321 UniProt:  P01355 A6I437 LinkDB All DBs Position 8:complement(130031012..130037702) Genome browser AA seq 115 aa AA seqDB search MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaagtgcggcgtgtgtctgtgcgtggtgatggcagtcctggcagcaggcgccctggcg cagccggtagtccctgtagaagctgtggaccctatggagcagcgggcggaggaggcgccc cgaaggcagctgagggctgtgctccgaccggacagcgagccccgagcgcgcctgggcgca ctgctagcccgatacatccagcaggtccgcaaagctccctctggccgcatgtccgttctt aagaacctgcagggcctggaccctagccataggataagtgaccgggactacatgggctgg atggatttcggccggcgcagtgctgaggactacgaatacccatcgtag

DBGET integrated database retrieval system