Rattus norvegicus (rat): 25404 Help Entry 25404             CDS       T01003                                  Symbol Cav1 Name (RefSeq) caveolin-1 isoform alpha   KO K06278   caveolin 1 Organism rno  Rattus norvegicus (rat) Pathway rno04144   Endocytosis rno04510   Focal adhesion rno05020   Prion disease rno05100   Bacterial invasion of epithelial cells rno05205   Proteoglycans in cancer rno05416   Viral myocarditis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     25404 (Cav1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     25404 (Cav1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     25404 (Cav1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     25404 (Cav1)   09164 Neurodegenerative disease    05020 Prion disease     25404 (Cav1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     25404 (Cav1)    05416 Viral myocarditis     25404 (Cav1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     25404 (Cav1) Membrane trafficking [BR:rno04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     25404 (Cav1) SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  25404 NCBI-ProteinID:  NP_113744 RGD:  2280 Ensembl:  ENSRNOG00000056836 UniProt:  Q2IBC6 Q3MHT6 A0A0G2K682 LinkDB All DBs Position 4:46606538..46639616 Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtctgggggtaaatacgtagactccgagggacatctctacactgttcccatccgggaa cagggcaacatctacaagcccaacaacaaggccatggcagacgaggtgaatgagaagcaa gtgtacgacgcgcacaccaaggagattgatctggtcaaccgcgaccccaagcatctcaac gacgacgtggtcaagattgactttgaagatgtgattgcggaaccagaagggacacacagt ttcgacggcatctggaaggccagcttcaccaccttcactgtgacaaaatattggttttac cgcttgctgtctaccatcttcggcatccctatggcgctcatctggggcatctactttgcc atcctctctttcctgcacatctgggcagttgtaccgtgcatcaagagcttcctgattgag attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgatccactcttt gaagcgattggcaagatattcagcaatatccgcatcagcacgcagaaagagatatga

DBGET integrated database retrieval system