Rattus norvegicus (rat): 25482 Help Entry 25482             CDS       T01003                                  Symbol Mras Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism rno  Rattus norvegicus (rat) Pathway rno04010   MAPK signaling pathway rno04014   Ras signaling pathway rno04015   Rap1 signaling pathway rno04072   Phospholipase D signaling pathway rno04137   Mitophagy - animal rno04140   Autophagy - animal rno04218   Cellular senescence rno04371   Apelin signaling pathway rno04625   C-type lectin receptor signaling pathway rno04810   Regulation of actin cytoskeleton rno05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     25482 (Mras)    04014 Ras signaling pathway     25482 (Mras)    04015 Rap1 signaling pathway     25482 (Mras)    04371 Apelin signaling pathway     25482 (Mras)    04072 Phospholipase D signaling pathway     25482 (Mras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     25482 (Mras)    04137 Mitophagy - animal     25482 (Mras)   09143 Cell growth and death    04218 Cellular senescence     25482 (Mras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     25482 (Mras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     25482 (Mras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     25482 (Mras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:rno04031]     25482 (Mras) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     25482 (Mras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 G-alpha FeoB_N AAA_16 Motif Other DBs NCBI-GeneID:  25482 NCBI-ProteinID:  NP_001375430 RGD:  3111 Ensembl:  ENSRNOG00000014060 UniProt:  A0A0G2K389 A6I2D6 LinkDB All DBs Position 8:complement(108823374..108886104) Genome browser AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVP EKNQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagcgctgttcccagtgacaaccttcccacatataaactggtagtggtggga gatggcggtgtgggcaagagtgctctcactattcagtttttccagaagatcttcgtgcct gactacgaccccaccattgaagactcctacctgaagcatacagagatcgacaatcaatgg gccatcttggacgttctggacacagctgggcaggaggagttcagtgccatgcgggagcaa tacatgcgcacaggggatggcttcctcattgtctactctgtcaccgacaaggccagcttc gagcacgtggaccgcttccaccagctcattctgcgtgtcaaggacagggagtcattccca atgatcctcgtggccaacaaagtggacctgatgcacctaaggaaaatcaccagggaccaa ggaaaagaaatggcgaccaaatacaatatcccatatatagaaaccagtgccaaggacccg cctctcaacgtggacaaaaccttccatgacctagttagagtaattaggcaacaggttcca gagaaaaaccagaagaagaaaaagaagacaaaatggcgaggggacagggccaccggcact cacaaactacagtgtgtcatcttgtga

DBGET integrated database retrieval system