KEGG   Rattus norvegicus (rat): 25509
Entry
25509             CDS       T01003                                 

Gene name
Pax6
Definition
(RefSeq) paired box protein Pax-6
  KO
K08031  paired box protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25509 (Pax6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25509 (Pax6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25509 (Pax6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    25509 (Pax6)
SSDB
Motif
Pfam: PAX Homeodomain HTH_32 HTH_23 HTH_Tnp_IS1 Homeobox_KN HTH_28
Other DBs
NCBI-GeneID: 25509
NCBI-ProteinID: NP_037133
RGD: 3258
Ensembl: ENSRNOG00000004410
UniProt: P63016
LinkDB
Position
3
AA seq 422 aa
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRY
YETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSV
SSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQ
EGQGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFAR
ERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQPIP
QPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPT
SPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYWPR
LQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcagaacagtcacagcggagtgaatcagcttggtggtgtctttgtcaacgggcggcca
ctgccggactccacccggcagaagatcgtagagctagctcacagcggggcccggccgtgc
gacatttcccgaattctgcaggtgtccaacggatgtgtgagtaaaattctgggcaggtat
tacgagactggctccatcagacccagggcaatcggaggcagtaagccaagagtggcgact
ccagaagttgtaagcaaaatagcccagtataaacgggagtgcccgtccatctttgcttgg
gaaatccgagacagattactctccgagggggtctgtaccaacgacaatatacccagtgtg
tcatcaataaacagagttcttcgcaacctggctagcgaaaagcaacagatgggcgcagac
ggcatgtatgataaactaaggatgctgaacggacagaccggaagctggggcacccgccct
ggttggtatcccgggacgtcagtaccagggcaacccacgcaagacggctgccagcaacag
gaaggacagggagaaaacaccaactccatcagctccaatggagaagactcggatgaggct
caaatgcggctgcagctgaagcggaagctgcagagaaatagaacatcttttacccaggag
cagattgaggctctggagaaagagtttgagaggacccattatccagatgtgtttgcccgg
gaaagactagcagccaaaatagatctacctgaagcaaggatacaggtgtggttttctaac
cgaagggccaagtggagaagagaagaaaaactgaggaaccagagaagacaggccagcaac
accccgagtcacatccctatcagcagcagtttcagtaccagtgtctaccagccaattcca
cagcccaccacacctgtctcctcctttacatcgggttccatgttgggccgcacagacacc
gccctcaccaacacgtacagtgctttgccgccgatgcccagcttcaccatggcaaataac
ctgcctatgcaacccccagtccccagtcagacctcctcgtactcctgcatgctgcccacc
agcccttcagtgaatgggcggagttatgatacctacacccctccgcacatgcaaacacac
atgaacagtcagcccatgggcacctcgggaaccacttcaacaggactcatttcacctgga
gtgtcagttcccgtccaagttcccggaagtgaacctgacatgtctcagtactggcctcga
ttacagtaa

DBGET integrated database retrieval system