Rattus norvegicus (rat): 25542 Help Entry 25542             CDS       T01003                                  Symbol Ccl3 Name (RefSeq) C-C motif chemokine 3 precursor   KO K05408   C-C motif chemokine 3 Organism rno  Rattus norvegicus (rat) Pathway rno04060   Cytokine-cytokine receptor interaction rno04061   Viral protein interaction with cytokine and cytokine receptor rno04062   Chemokine signaling pathway rno04620   Toll-like receptor signaling pathway rno05142   Chagas disease rno05163   Human cytomegalovirus infection rno05323   Rheumatoid arthritis rno05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     25542 (Ccl3)    04061 Viral protein interaction with cytokine and cytokine receptor     25542 (Ccl3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     25542 (Ccl3)    04062 Chemokine signaling pathway     25542 (Ccl3)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     25542 (Ccl3)   09174 Infectious disease: parasitic    05142 Chagas disease     25542 (Ccl3)   09163 Immune disease    05323 Rheumatoid arthritis     25542 (Ccl3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     25542 (Ccl3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rno04052]     25542 (Ccl3)    00536 Glycosaminoglycan binding proteins [BR:rno00536]     25542 (Ccl3) Cytokines and neuropeptides [BR:rno04052]  Cytokines   Chemokines    25542 (Ccl3) Glycosaminoglycan binding proteins [BR:rno00536]  Heparan sulfate / Heparin   Chemokines    25542 (Ccl3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  25542 NCBI-ProteinID:  NP_037157 RGD:  3647 Ensembl:  ENSRNOG00000011205 Vega:  OTTRNOG00000000486 UniProt:  P50229 A6HHI7 LinkDB All DBs Position 10:complement(68948889..68950439) Genome browser AA seq 92 aa AA seqDB search MKVSTAALAVLLCTMALWNEVFSAPYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQP GVIFLTKRNRQICADPKETWVQEYITELELNA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccaccgctgcccttgctgttcttctctgcaccatggcgctctggaacgaa gtcttctcagcgccatatggagctgacaccccgactgcctgctgcttctcctatggacgg caaattccacgaaaattcattgctgactattttgagaccagcagcctttgctcccagccg ggtgtcattttcctgaccaagagaaaccggcagatctgcgctgaccccaaagagacctgg gtccaagaatacatcactgagctggaactaaatgcctga

DBGET integrated database retrieval system