KEGG   Rattus norvegicus (rat): 25640
Entry
25640             CDS       T01003                                 

Gene name
Hnf1b
Definition
(RefSeq) hepatocyte nuclear factor 1-beta isoform 2
  KO
K08034  transcription factor 2, hepatocyte nuclear factor 1-beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25640 (Hnf1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25640 (Hnf1b)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    25640 (Hnf1b)
SSDB
Motif
Pfam: HNF-1B_C HNF-1_N Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 25640
NCBI-ProteinID: NP_037235
RGD: 3830
Ensembl: ENSRNOG00000002598
UniProt: P23899
LinkDB
Position
10
AA seq 557 aa
MVSKLTSLQQELLSALLSSGVTKEVLIQALEELLPSPNFGVKLETLPLSPGSGADLDTKP
VFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWR
AAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREIL
RQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQNQGPGQSEDACSEPTNKKMRRNRFKWGP
ASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWF
ANRRKEEAFRQKLAMDAYSSNQTHNLNPLLTHGSPHHQPSSSPPNKLSGVRYSQPGNNEV
TSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHSLLSPDSKMISVSGGGLPPVSTLTNIH
SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQGVPVINSVASSLAALQPVQFSQQLHS
PHQQPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSI
NTLTSMSSSKQCPLQAW
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggtgtccaagctcacgtctctccagcaagaactcctgagtgccctgctgagctccgga
gtcaccaaggaagtgctgatccaggccttggaggaattactgccgtccccgaatttcggg
gtgaagctggagacactgcccctgtcccccgggagcggggcggatctcgacaccaagccg
gttttccatactctcaccaatggccacgccaagggccgcttgtctggggacgagggctca
gaggacggcgacgactatgacactcctcccatcctcaaagagctccaggcgctcaacacc
gaggaggccgcggagcagcgggccgaggtggaccggatgctcagtgaggacccatggagg
gccgccaaaatgatcaagggatacatgcaacagcacaacatcccccagagggaggtggtt
gatgtcacaggcctgaaccaatcccacctttctcaacacctcaacaagggcacccccatg
aagacccagaagcgagctgccctgtacacctggtacgtcagaaagcaacgggagatcctc
cgacagttcaaccagacagtccagagctctggaaacatgacagacaaaagcagtcaggat
cagctgctatttctctttccagagttcagtcaacagaaccagggccctgggcagtcggag
gacgcctgctctgagcccaccaacaagaagatgcgccgcaaccggttcaaatgggggccc
gcatcccagcaaattttgtaccaggcctacgaccggcaaaagaatcccagcaaggaagag
agggaggccttagtggaggagtgtaacagggcagaatgtttgcaacgaggggtctccccc
tccaaagcccatggcctaggctccaacttggtcacggaggtccgtgtctacaactggttt
gcaaaccgccggaaggaagaggcattcagacagaagctggccatggatgcctatagctcc
aaccagacgcacaacttgaaccccctgctcacccatggctcccctcaccaccagccaagc
tcctctccacccaacaagttgtcaggagtacgctacagccaaccgggaaacaatgaggtc
acttcctcttcgacaatcagtcaccatggtaacagtgccatggtgaccagccagtcagtt
ttacaacaagtctccccggccagcctggacccaggccacagtctcctctcacctgacagt
aaaatgatctcggtgtctggaggaggactgcccccggtcagcaccttgacgaatatccac
agcctctcccaccacaatccccagcaatctcaaaacctcatcatgactcccctgtccgga
gtcatggccattgcacagagcctcaacacctcccaagcccagggtgtcccagtcatcaac
agtgtggctagcagcctggcagccctacagcccgtccagttctctcaacagctgcacagc
cctcaccagcagcccctcatgcagcagagcccaggcagtcacatggcccagcagcccttc
atggctgcggtgactcagctacagaactcccacatgtatgcacataagcaggagccccct
cagtattcccacacctcccggttcccatctgcaatggtggtcacagataccagtagcatc
aataccctcaccagcatgtcttccagtaaacagtgtccactgcaagcctggtga

DBGET integrated database retrieval system