KEGG   Rattus norvegicus (rat): 25728
Entry
25728             CDS       T01003                                 
Symbol
Apoe
Name
(RefSeq) apolipoprotein E precursor
  KO
K04524  apolipoprotein E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04979  Cholesterol metabolism
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    25728 (Apoe)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25728 (Apoe)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25728 (Apoe)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25728 (Apoe)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   25728 (Apoe)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   25728 (Apoe)
SSDB
Motif
Pfam: Apolipoprotein Baculo_PEP_C ApoLp-III GldM_N PIN_8 DUF1043 RRF Phage_Mu_Gam Baculo_p24 YtxH Prominin Phasin DUF1664 DUF1690 BshC RmuC Fib_alpha DIT1_PvcA Tyrosinase DUF1451
Other DBs
NCBI-GeneID: 25728
NCBI-ProteinID: NP_001257610
RGD: 2138
Ensembl: ENSRNOG00000018454
UniProt: P02650
LinkDB
Position
1:complement(79353924..79357852)
AA seq 312 aa
MKALWALLLVPLLTGCLAEGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEE
LQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMED
LRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGA
ERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLE
EVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATN
SIASTTVPLENQ
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaaggctctgtgggccctgctgttggtcccattgctgacaggatgcctggccgaggga
gagctggaggtgacagatcagctcccagggcaaagcgaccaaccctgggagcaggccctg
aaccgcttctgggattacctgcgctgggtgcagacgctttctgaccaggtccaggaagag
ctgcagagctcccaagtcacacaggaactgacggtactgatggaggacactatgacggaa
gtaaaggcatacaaaaaggagctggaggaacagctgggcccagtggcggaggagacacgg
gccaggctggctaaagaggtgcaggcggcacaggcccgtctgggagctgacatggaggat
ctacgcaaccgactcgggcagtaccgcaacgaggtaaacaccatgctgggccagagcaca
gaggagctgcggtcgcgcctctccacacacctgcgcaagatgcgcaagcgcctgatgcgg
gatgcggatgatctgcagaagcgcctggcggtgtacaaggccggggcacaggagggcgcc
gagcgcggtgtgagtgctatccgtgagcgcctggggccactggtggagcagggtcgtcag
cgcacagccaacctaggcgctggcgccgcccagcccctgcgcgatcgcgcccaggctttg
agtgaccgcatccgagggcggctggaggaagtgggcaaccaggcccgagaccgcctagag
gaggtgcgtgagcagatggaggaggtgcgctccaagatggaggagcagacccagcagata
cgcctgcaggccgagatcttccaggcccgcatcaagggctggttcgagccgctagtggaa
gacatgcagcgccagtgggcaaacctaatggagaagatacaggcctctgtggctaccaac
tccattgcctccaccacagtgcccctggagaatcaatga

DBGET integrated database retrieval system