KEGG   Rattus norvegicus (rat): 25735
Entry
25735             CDS       T01003                                 

Gene name
Hnf4a
Definition
(RefSeq) hepatocyte nuclear factor 4-alpha isoform 1
  KO
K07292  hepatocyte nuclear factor 4-alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    25735 (Hnf4a)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25735 (Hnf4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25735 (Hnf4a)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    25735 (Hnf4a)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    25735 (Hnf4a)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   25735 (Hnf4a)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 25735
NCBI-ProteinID: NP_071516
RGD: 2810
Ensembl: ENSRNOG00000008895
UniProt: P22449 A0A0G2K0G1
LinkDB
Position
3
AA seq 474 aa
MRLSKTLADMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNSSNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKR
IANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSASDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEW
PRPRGQAATPETPQPSPPSGSGSESYKLLPGAITTIVKPPSAIPQPTITKQEAI
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgcgactctctaaaaccctcgccgacatggacatggctgactacagtgctgccttggac
ccagcctacaccaccctggagtttgaaaatgtgcaggtgttgaccatgggcaatgacaca
tccccatctgaaggtgccaacctcaactcatccaacagcctgggtgtcagtgccctgtgt
gccatctgtggcgatcgggccactggcaaacactacggagcctcaagctgtgacggctgc
aagggattcttcaggaggagcgtgaggaagaaccacatgtactcctgcaggtttagcagg
cagtgcgtggtagacaaagataagaggaaccagtgtcgttactgcaggctcaagaagtgc
ttccgggctggcatgaagaaagaagccgtccaaaatgagcgggatcggatcagcacgcgg
aggtcaagctacgaggacagcagcctaccctccattaatgcgctcctgcaggcagaggtc
ctgtctcagcagatcacctcccccatctctgggatcaatggcgacattcgggccaagagg
attgccaacatcacggatgtgtgtgagtctatgaaggagcagctgctggttctggtcgaa
tgggccaagtacatcccggccttctgtgaacttcttctggatgaccaggtggcgctgctc
agagcccacgctggtgagcacctgctgcttggagccaccaagaggtccatggtgttcaag
gatgtgctgctcctaggcaatgactacatcgtccctcggcactgtccagagctagcagag
atgagccgtgtgtccattcgcatcctcgatgagctggtcttgcccttccaagagctgcag
atcgatgataatgaatacgcctgcctcaaagccatcatcttctttgacccagatgccaag
gggctgagtgacccaggcaagatcaagcggctgcggtcacaggtgcaggtgagcctggag
gattacatcaacgaccggcagtatgactctcggggtcgttttggagagctgctgctgctc
ctgcccactctgcagagcattacctggcagatgatcgagcagatccagttcatcaagctc
tttggcatggccaagattgacaacctgctgcaggagatgctgcttggagggtctgccagt
gacgcgccccacgcccaccaccccctgcaccctcacctgatgcaagaacacatgggcacc
aatgtcatagttgccaacacgatgccctctcacctcagcaatggacagatgtgtgagtgg
ccccggcccagggggcaggcagccacccctgagactccacagccatcaccaccaagtggc
tctggatctgaatcctacaagctcctgccaggagccatcaccaccatcgtcaagcctccc
tctgccatcccccagccaacgatcaccaagcaggaagccatctag

DBGET integrated database retrieval system