KEGG   Rattus norvegicus (rat): 288271
Entry
288271            CDS       T01003                                 
Symbol
Mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    288271 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    288271 (Mrap)
SSDB
Motif
Pfam: MRAP DUF5542
Other DBs
NCBI-GeneID: 288271
NCBI-ProteinID: NP_001129306
RGD: 1310648
Ensembl: ENSRNOG00000021524
UniProt: D4A897
LinkDB
Position
11:29991974..30003024
AA seq 127 aa
MANRTDASVPFTSYEYYLDYIDLIPVDEKKLKANKHSIVIALWLSLATFVVLLFFILLYM
SWSGSPQVRHSPQAYQVCSWTHGFHLPLCLRRASLQTTDEPGSRAGIDQWLQQQSPSASP
AGPLALP
NT seq 384 nt   +upstreamnt  +downstreamnt
atggccaacaggaccgatgcctctgtcccgttcaccagctatgaatattacctggactac
atagacctcattcctgtggacgagaagaagctgaaagccaacaagcactccattgtcatt
gccttgtggttgagcctggctacttttgtggtgctcctcttcttcattctgctctacatg
tcctggtcaggctccccacaggtaaggcatagtccccaagcctaccaagtatgttcatgg
actcacggcttccacctccccctgtgtctccggagggcctccctgcagacaacagatgag
ccaggaagtagagctggcattgaccaatggttacagcagcagagtccttctgcctcgccc
gctgggcccctggctctcccctag

DBGET integrated database retrieval system