Rattus norvegicus (rat): 288779 Help Entry 288779            CDS       T01003                                  Symbol Rab5b Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism rno  Rattus norvegicus (rat) Pathway rno04014   Ras signaling pathway rno04137   Mitophagy - animal rno04144   Endocytosis rno04145   Phagosome rno04148   Efferocytosis rno04962   Vasopressin-regulated water reabsorption rno05132   Salmonella infection rno05146   Amoebiasis rno05152   Tuberculosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     288779 (Rab5b)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     288779 (Rab5b)    04145 Phagosome     288779 (Rab5b)    04137 Mitophagy - animal     288779 (Rab5b)    04148 Efferocytosis     288779 (Rab5b)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     288779 (Rab5b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     288779 (Rab5b)    05152 Tuberculosis     288779 (Rab5b)   09174 Infectious disease: parasitic    05146 Amoebiasis     288779 (Rab5b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     288779 (Rab5b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     288779 (Rab5b)    04031 GTP-binding proteins [BR:rno04031]     288779 (Rab5b) Membrane trafficking [BR:rno04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     288779 (Rab5b)  Endosome - Lysosome transport     288779 (Rab5b) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    288779 (Rab5b)   Exosomal proteins of other body fluids (saliva and urine)    288779 (Rab5b)   Exosomal proteins of colorectal cancer cells    288779 (Rab5b)   Exosomal proteins of melanoma cells    288779 (Rab5b) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     288779 (Rab5b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  288779 NCBI-ProteinID:  NP_001073405 RGD:  1306489 Ensembl:  ENSRNOG00000006130 UniProt:  F7F3T1 A1L1J8 LinkDB All DBs Position 7:complement(1693971..1712936) Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNPGGAAGRSRGVDLHEQAQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagtacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggagaatctgcagtggggaagtcgagcctggtgttacgtttt gtcaaaggacagttccatgaataccaggaaagtaccattggagcggccttcctcacccag tcggtgtgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa cgataccacagtttagcccccatgtactacaggggtgcccaggctgccatcgtggtctat gatatcactaatcaggaaacgtttgcccgggcaaagacatgggtaaaggaactacagcgg caagccagccctagcatcgtcattgccttggcagggaacaaagctgaccttgccaacaag cgcatggtggagtatgaagaggctcaggcatatgcagatgacaacagcttattatttatg gagacttcagctaagactgctatgaacgtgaatgatctcttcctggcaatagcaaagaag ttgccaaagagtgaaccccagaatccagggggtgcagcaggccgaagtcggggcgtggat cttcatgagcaggcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system