KEGG   Rattus norvegicus (rat): 292788
Entry
292788            CDS       T01003                                 
Symbol
Psenen
Name
(RefSeq) gamma-secretase subunit PEN-2
  KO
K06170  presenilin enhancer 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    292788 (Psenen)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    292788 (Psenen)
SSDB
Motif
Pfam: PEN-2 DUF6427
Other DBs
NCBI-GeneID: 292788
NCBI-ProteinID: NP_001008764
RGD: 1312037
Ensembl: ENSRNOG00000020941
UniProt: Q6QI68
LinkDB
Position
1:complement(85814905..85816654)
AA seq 101 aa
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS
AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaacttagagcgggtgtccaatgaggagaagttgaacctgtgccggaagtactatctt
ggtggatttgcatttctgccttttctttggttggtcaacattttctggttcttcaaagag
gccttcttcgctccagcctacacagagcagagccaaatcaaaggctatgtttggcgctca
gctgtgggcttcctcttctgggtgattgttctcaccacctggatcaccatcttccagatc
taccggccccgctggggtgctcttggggactacctctccttcaccattcccctgggcact
ccctga

DBGET integrated database retrieval system