KEGG   Rattus norvegicus (rat): 292804
Entry
292804            CDS       T01003                                 

Gene name
Gpi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rno_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    292804 (Gpi)
   00030 Pentose phosphate pathway
    292804 (Gpi)
   00500 Starch and sucrose metabolism
    292804 (Gpi)
   00520 Amino sugar and nucleotide sugar metabolism
    292804 (Gpi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    292804 (Gpi)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     292804 (Gpi)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   292804 (Gpi)
  Exosomal proteins of other body fluids (saliva and urine)
   292804 (Gpi)
  Exosomal proteins of colorectal cancer cells
   292804 (Gpi)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-GeneID: 292804
NCBI-ProteinID: NP_997475
RGD: 2727
Ensembl: ENSRNOG00000023150
Vega: OTTRNOG00000001067
UniProt: Q6P6V0
LinkDB
Position
1
AA seq 558 aa
MAALTRNPEFQKLLEWHRANSANLKLRELFEADPERFNHFSLNLNTNHGHILLDYSKNLV
NKEVLHMLVDLAKSRGVEAARDNMFSGLKINSTEDRAVLHVALRNRSNRSIMMDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKAITDIINIGIGGSDLGPLMVTEALKPYSKGGPR
VWFVSNIDGTHIAKTLANLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTDKVKEFGIDPKNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGA
HWMDQHFMKTPLDKNAPVLLALLGIWYINFYGCETHAMLPYDQYMHRFAAYFQQGDMESN
GKYITKSGARVDYQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRNGL
HHKILLANFLAQTEALMKGKSPEEARKELQAAGKSPEELEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSSAVTSHDS
STNGLIGFIKLQRDTKID
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctgcgctcacccggaacccggagttccagaagctgctggagtggcaccgggcgaac
tctgccaacctcaagctgcgcgaactttttgaggcagatccggagcgcttcaaccacttc
agcttgaacctcaacaccaaccatggacatattctgttggattactccaagaaccttgtg
aacaaggaggtgttgcacatgctggtggacctggccaagtccagaggcgtggaggccgcg
cgggacaacatgttcagtggtttgaagatcaactccaccgaggaccgggcggtgctgcac
gtggcccttcggaaccggtccaacagatccatcatgatggacggcaaagacgtgatgcca
gaggtcaacaaggtgctggacaagatgaagtctttctgccagcgggtccggagtggtgac
tggaaagggtacaccggcaaagctatcacggacatcatcaacatcggcattggaggctcc
gacctgggacccctcatggtgactgaagctctcaagccttactctaaaggaggtcccaga
gtctggtttgtctccaacattgatgggacccacattgccaaaacattggccaacctgaac
cctgagtcttccctctttataatcgcctccaagaccttcaccacccaggagaccatcacc
aacgcagagactgccaaagagtggtttctccaagctgcgaaggatccgtctgcagttgca
aagcactttgttgccctgtctacgaacacggacaaagtgaaggagtttggaattgaccct
aaaaacatgttcgagttctgggattgggtaggtggccgctactcgctgtggtcagccatt
ggactctccatcgcactgcatgtgggttttgaccactttgaacagctgctgtccggggct
cactggatggaccagcacttcatgaagacgcccctggataagaatgcccccgtcctgctg
gctctcctgggcatctggtatatcaacttctacggctgtgagacccacgccatgctgccc
tatgaccagtacatgcaccgctttgctgcctatttccagcagggtgacatggaatccaat
ggaaagtacatcaccaagtctggagcccgggttgactaccagacaggccccattgtgtgg
ggggagccagggaccaacggtcaacatgcattctaccagcttatccaccaaggcaccaag
atgataccctgtgatttcctcatccctgttcagacccagcaccccatacggaatggtctg
catcacaagatcctcctggccaacttcttggcccagactgaggccctgatgaaggggaag
tcgccagaagaggccaggaaggagctccaggctgccggaaagagcccagaagaactggag
aaactcttgccacacaaggtctttgaaggaaaccggccgaccaactcaattgtgtttacc
aagctaacacccttcattctgggagcactgattgccatgtatgagcacaagatcttcgtt
cagggcatcatctgggacatcaacagcttcgaccagtggggagtggagctggggaagcag
ctggccaagaaaattgagccagagctggacggcagctctgccgtaacctcccatgactcc
tccactaatggactgatcggcttcatcaagctgcagcgcgacaccaaaatagattaa

DBGET integrated database retrieval system