KEGG   Rattus norvegicus (rat): 293897
Entry
293897            CDS       T01003                                 
Symbol
Dkk1
Name
(RefSeq) dickkopf-related protein 1 precursor
  KO
K02165  dickkopf 1/2/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    293897 (Dkk1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293897 (Dkk1)
   05022 Pathways of neurodegeneration - multiple diseases
    293897 (Dkk1)
SSDB
Motif
Pfam: Dickkopf_N Toxin_19
Other DBs
NCBI-GeneID: 293897
NCBI-ProteinID: NP_001099820
RGD: 1307313
Ensembl: ENSRNOG00000011692
UniProt: D3Z9J1
LinkDB
Position
1:complement(228381521..228385202)
AA seq 270 aa
MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSA
VSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKR
RKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTS
KIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQR
CYCGEGLACRIQKDHHQTSNSSRLHTCQRH
NT seq 813 nt   +upstreamnt  +downstreamnt
atgacggttgtgcgtgcagtggcagctgtccggttcttggtcgtgctttcaacgatggct
ctctgcagcctccctccgctcggagtcagcgccaccttgaactcagttctcatcaattcc
aacgcgatcaagaacctgcccccaccgctgggtggtgctggggggcagccgggctctgct
gtcagcgtggcgcccggagtcctctatgagggcgggaacaagtaccagactcttgacaac
taccagccctacccttgcgcggaggatgaggagtgcggcactgacgagtactgctccagt
cccagccgcggggcagccggcgtgggaggtgtacaaatctgcctggcttgccgaaagcgc
aggaaacgctgcatgaggcacgctatgtgctgccccgggaattactgcaaaaacggaata
tgcatgccctctgaccacagccatttacctcgaggggaaatcgaggaaggcatcattgaa
aaccttggcaatgaccacggtgccggggatggatatcccagaagaaccacactgacttca
aaaatatatcacaccaaagggcaagaaggctctgtctgcctccgatcatcagactgcgcc
acagggctgtgttgtgcaagacatttctggtccaagatctgtaaacctgtccttaaagaa
ggtcaggtatgcaccaagcacaggaggaaaggctcccacgggctggagatattccagcgc
tgttactgtggggaaggtctggcttgcaggatacagaaagatcaccatcaaaccagcaat
tcttccaggctccacacctgccagagacactaa

KEGG   Rattus norvegicus (rat): 295445
Entry
295445            CDS       T01003                                 
Symbol
Dkk2
Name
(RefSeq) dickkopf-related protein 2 precursor
  KO
K02165  dickkopf 1/2/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    295445 (Dkk2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    295445 (Dkk2)
   05022 Pathways of neurodegeneration - multiple diseases
    295445 (Dkk2)
SSDB
Motif
Pfam: Dickkopf_N DUF4501
Other DBs
NCBI-GeneID: 295445
NCBI-ProteinID: NP_001099942
RGD: 1308639
Ensembl: ENSRNOG00000011360
UniProt: D3ZN48
LinkDB
Position
2:220568338..220660225
AA seq 259 aa
MAALMRVKDSSRCLLLLAAVLMVESSQLSSSRAKLNSIKSSLGGETPAQAANRSAGMNQG
LAFGGSKKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPGT
RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKGHEG
DPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
VWKDATYSSKARLHVCQKI
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccgcgctgatgcgggtcaaggattcatcccgctgccttctcctactggccgcggtg
ctgatggtggagagttcacagctaagcagctcgcgggccaaactcaactccatcaagtcc
tctctaggtggggagacgcctgctcaggctgccaatcgatctgcgggcatgaaccaagga
ctggctttcggcggcagtaagaagggcaaaagtctggggcaggcctacccttgcagcagc
gataaggaatgcgaagttggaagatactgccacagtccccaccaaggatcttcagcctgc
atggtctgtcggaggaaaaagaagcgatgccatagagatgggatgtgttgccctggtacc
cgctgtaataatggcatctgcattccagtcactgagagcatcctgaccccacatatcccg
gctctggatggcactcggcatagggatcgcaaccatggtcactattccaaccatgacctg
ggatggcagaatctaggaaggccacactccaagatgcctcatataaagggacatgaagga
gacccctgtctgcggtcatcagactgcattgatgggttttgttgtgctcgccacttctgg
accaaaatctgcaaaccagtgctccatcagggggaagtctgtaccaaacaacgcaagaag
ggttcacatgggctggagattttccagaggtgtgactgtgcaaagggcctgtcctgcaaa
gtgtggaaggatgctacctactcttccaaagccagactccatgtgtgccagaagatctga

KEGG   Rattus norvegicus (rat): 502097
Entry
502097            CDS       T01003                                 
Symbol
Dkk4
Name
(RefSeq) dickkopf-related protein 4 precursor
  KO
K02165  dickkopf 1/2/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    502097 (Dkk4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    502097 (Dkk4)
   05022 Pathways of neurodegeneration - multiple diseases
    502097 (Dkk4)
SSDB
Motif
Pfam: Dickkopf_N Prokineticin
Other DBs
NCBI-GeneID: 502097
NCBI-ProteinID: NP_001102802
RGD: 1563172
Ensembl: ENSRNOG00000019267
UniProt: D4ADQ6
LinkDB
Position
16:complement(69402989..69406580)
AA seq 221 aa
MVLVALLGLSWFCSPLGALVLDFNNIKSSSDVQGSGKGSQCVSDKDCNVGKFCFALHDER
SFCATCRRVRRRCQRSAMCCPGTVCVNDVCTAVENTRPVMDRNTDGQDGTYAEGTTKWPA
EENRPQGKPSTKKSQSNKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLSCRSQVTGNRQHTRLRVCQRI
NT seq 666 nt   +upstreamnt  +downstreamnt
atggtcctggtggccttgcttggactcagctggttctgttcacccctgggagccctggtt
ctggattttaacaacatcaagagctcctcagatgtgcaaggctctgggaagggctcacag
tgtgtgtcagacaaggattgcaacgtaggaaaattctgcttcgcgctccatgatgaaagg
tccttctgtgccacgtgccgcagagttcgcaggagatgccagaggagcgccatgtgctgc
ccaggaacggtctgcgtgaatgatgtttgcactgcagtggaaaacacgaggccagtgatg
gacagaaacaccgacggccaagatggcacctacgcagagggaaccaccaaatggccagcg
gaggaaaacagacctcaggggaagcccagtacgaagaaatcacaaagcaataagggacag
gagggagaaagctgtctcagaacctccgactgcggccctggactttgctgtgctcgccat
ttttggaccaaaatttgcaagccagttctactagagggacaagtgtgttccaggaggggg
cacaaagacactgcccaagccccagaaatcttccagcgctgtgactgtggtcctggactg
tcctgtcgaagtcaggtgactggtaaccgacaacatacaaggctaagagtatgccaaaga
atataa

DBGET integrated database retrieval system