KEGG   Rattus norvegicus (rat): 294395
Entry
294395            CDS       T01003                                 

Gene name
Rfx6
Definition
(RefSeq) DNA-binding protein RFX6
  KO
K19521  regulatory factor X 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    294395 (Rfx6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    294395 (Rfx6)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other basic domains
   RF-X
    294395 (Rfx6)
SSDB
Other DBs
NCBI-GeneID: 294395
NCBI-ProteinID: NP_001099858
RGD: 1307491
Ensembl: ENSRNOG00000027949
UniProt: F1LTN7
LinkDB
Position
20
AA seq 747 aa
MIIHIQGAYHYYGIGIKESSAYYHSVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLL
PEFPSAQHLVYPGCIAKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPDH
LLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFAKNWEQWVVSSL
ENLPEALIDKKIPILRRFVSSLKRQTSFLHLAQIARPALFDQHVVNAMVSDIEKVDLNSI
GSQALLTISNSTDTESDIYSEYDSITVFQELKDLLKKNATVEAFIEWLDTVVEQRVIKMS
KQNGRSLKKRAQDFLLKWSFFGARVMHNLTLNNASSFGSLHLIRMLLDEYILLAMETQFN
NDKEQELQNLLDKYMKNSEASKAAFTASPSSCFLANRNKGSSLSSDPVKNESHEETAYVP
LPSSQPLAVPHALHSFPAESTETMPLSGQIELSQSTGHLMTPPISPAIASRGSVINQGPM
AGRPSSVGTALSAPTHCPTYAEPIYPTLPPANHDFYGTNSNYQTVFRAQSHPASSLYAHR
AENGRCMAWTEQQLSRDFFGGSCAGSPYNSRPPSGYGPSPATQESHNMQFLNTGSFNFLS
NAGTGSCQGAALPSNSPNGYYGNNINYPEAHRLGSMVNQHVSVISSVRSLPPYSDIHDPL
NILDDSGRKQSNLFYAHTSSPVTCRTPVVASNLQTQIPPSSSQCMYGTSGQYPVQDNLDS
NGASDREMVSSLPPINTVFMGTAAGGT
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgattattcatattcagggggcgtatcattactatgggattggcatcaaagaaagcagc
gcctattaccactctgtttattctggaaagggcttgacaaggttttcggggagcaaactg
aagaatgagggtggttttactcgtaaatactcactcagctcaaaaacaggaacccttctt
ccagaattccccagcgctcaacatcttgtgtacccaggatgcattgctaaggataaggtt
gacactctcataatgatgtataagactcactgccagtgcatactcgacaacgccatcaat
gggaactttgaggagatccagcatttcctactgcacttttggcaaggaatgccagaccac
ctccttcccctgcttgaaaatcctgtaatcattgacattttctgtgtttgtgactcaatt
ctgtataaggttcttacagatgtcctcattcctgcaaccatgcaagaaatgcctgaaagc
ttattagcagatataagaaattttgctaaaaattgggaacagtgggttgtctcatctttg
gaaaacttgccagaagccctcattgacaagaaaatccccattttgcgaagattcgtatct
tctctgaagcgacagacatctttcttgcatcttgctcagattgccagaccagctctcttt
gaccagcatgtggtgaacgccatggtatctgatattgaaaaggttgacttaaatagtatt
ggatctcaggctcttcttaccatatccaacagcacagacacagaatccgacatctacagt
gaatatgactctatcactgtgttccaagagctgaaggatctccttaagaagaatgcgaca
gtggaagcttttattgaatggttggatactgtggtagaacagagagttattaagatgagc
aaacagaacggaagatctctgaagaagagagctcaagacttcctgctcaaatggagcttt
tttggtgcccgcgtaatgcataatctgaccttgaacaacgcatcgagttttggttctctc
catttgatccggatgcttctggatgaatacattctcctggctatggagactcaatttaac
aatgacaaagaacaggagctacagaatttattggacaagtatatgaagaactcggaggcg
agtaaagctgccttcacagcttccccgagctcatgctttctggccaaccgaaataagggc
agctcactttccagtgaccctgtgaagaatgaaagccacgaggagaccgcctatgttccc
ctgccttccagccagcctctggccgtaccccatgctctgcactcattcccagcggagagc
actgagaccatgcctctctcaggtcaaatagagctctcacaaagtactggccatctgatg
acgccacctatttctccagccatagcaagcagaggaagtgttattaaccaagggccaatg
gcgggcagaccctcgagcgtgggcacagctctctcagctccaacgcactgtccgacgtac
gcagaaccgatttatcctaccctccctccagccaaccacgacttttacgggaccaactct
aactatcagactgtgtttagggcacagtctcaccctgcgtcaagtctctatgctcaccgt
gcagagaacgggcgatgcatggcttggacggaacagcagctttctagagacttcttcggg
ggcagctgtgctgggtctccgtataattccaggccgccttccggttatgggccatccccc
gcaacccaagagtcacacaacatgcagtttttgaacacagggagcttcaatttcctcagt
aacgcaggaactggcagctgccaaggagcagccttaccttctaattctcctaatgggtac
tatggaaacaatataaactacccagaggcacataggctcggatcaatggtgaaccaacac
gtttcggtcatcagcagtgttcgctccctgcctccctacagtgacatccatgatccactt
aacattttagatgacagcggccggaagcagagcaacttgttttatgcacacacatcctct
cctgtcacatgtcggactcctgtagtggcttccaatttgcaaacccagattcctccctct
tcatcccagtgtatgtatggaacttctggtcagtatccagtgcaagataatctggattcc
aatggagcaagtgacagagaaatggtgtcctctttacctcccatcaacactgtgtttatg
gggacagcagctggaggcacttaa

DBGET integrated database retrieval system