KEGG   Rattus norvegicus (rat): 29458
Entry
29458             CDS       T01003                                 

Gene name
Neurod1
Definition
(RefSeq) neurogenic differentiation factor 1
  KO
K08033  neurogenic differentiation factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    29458 (Neurod1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29458 (Neurod1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    29458 (Neurod1)
SSDB
Motif
Pfam: Neuro_bHLH HLH CCDC106 YL1 Nop14 CDC45 Nop53
Other DBs
NCBI-GeneID: 29458
NCBI-ProteinID: NP_062091
RGD: 3165
Ensembl: ENSRNOG00000005609
Vega: OTTRNOG00000001284
UniProt: Q64289
LinkDB
Position
3
AA seq 357 aa
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDELEAMNAEEDSLRNGGEEE
DEDEDLEEEEEEEEEEDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNPDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSTEFEKNYAFT
MHYPAATLAGPQSHGSIFSSGAAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaccaaatcatacagcgagagcgggctgatgggcgagcctcagccccaaggtccccca
agctggacagacgagtgcctcagttctcaggacgaggaacacgaggcagacaagaaggag
gatgagcttgaagccatgaatgcagaggaggactctctgagaaatgggggagaggaggag
gatgaagatgaggatctggaagaggaggaagaggaggaggaagaggaggatgatcaaaag
cccaagagacggggccccaaaaagaaaaagatgaccaaggcgcgcctagagcgttttaaa
ttaagacgcatgaaggccaatgcccgcgagcggaaccgcatgcacgggctgaatgcggcg
ctggacaacctgagaaaggtggtaccctgctactctaagacacagaagctgtctaagata
gagacactgcgcttggccaagaactatatctgggctctgtcagagatcctgcgctcaggc
aaaagcccagacctcgtctcctttgtacagacactctgcaaaggtttgtcccagcccact
accaatttggtggctggctgcttgcagctcaacccccggactttcttgcctgagcagaat
ccggacatgcccccacacctgccaaccgccagcgcttccttcccggtgcatccctactcc
taccagtcccctggactgcccagcccgccctacggcaccatggacagctcccatgtcttc
cacgtcaagccgccgccacacgcctacagcgcagccctggagcccttctttgaaagcccc
ctaactgattgcaccagcccttcctttgacggacccctcagcccgccgctcagcatcaat
ggcaacttctctttcaaacacgaaccatccaccgagtttgaaaaaaattatgcctttacc
atgcactaccctgcagcgaccctggcagggccccaaagccacggatcaatcttctcctcg
ggtgccgctgctcctcgctgtgagatccccatagacaatattatgtctttcgatagccat
tcgcatcatgagcgagtcatgagtgcccagcttaatgccatctttcacgattag

DBGET integrated database retrieval system