Rattus norvegicus (rat): 29513 Help Entry 29513             CDS       T01003                                  Symbol Mapk13 Name (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04010   MAPK signaling pathway rno04015   Rap1 signaling pathway rno04068   FoxO signaling pathway rno04071   Sphingolipid signaling pathway rno04114   Oocyte meiosis rno04148   Efferocytosis rno04218   Cellular senescence rno04261   Adrenergic signaling in cardiomyocytes rno04370   VEGF signaling pathway rno04380   Osteoclast differentiation rno04550   Signaling pathways regulating pluripotency of stem cells rno04611   Platelet activation rno04613   Neutrophil extracellular trap formation rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04625   C-type lectin receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04664   Fc epsilon RI signaling pathway rno04668   TNF signaling pathway rno04670   Leukocyte transendothelial migration rno04714   Thermogenesis rno04722   Neurotrophin signaling pathway rno04723   Retrograde endocannabinoid signaling rno04728   Dopaminergic synapse rno04750   Inflammatory mediator regulation of TRP channels rno04912   GnRH signaling pathway rno04914   Progesterone-mediated oocyte maturation rno04917   Prolactin signaling pathway rno04926   Relaxin signaling pathway rno04932   Non-alcoholic fatty liver disease rno04933   AGE-RAGE signaling pathway in diabetic complications rno04935   Growth hormone synthesis, secretion and action rno04936   Alcoholic liver disease rno05014   Amyotrophic lateral sclerosis rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05140   Leishmaniasis rno05142   Chagas disease rno05145   Toxoplasmosis rno05152   Tuberculosis rno05161   Hepatitis B rno05163   Human cytomegalovirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05205   Proteoglycans in cancer rno05208   Chemical carcinogenesis - reactive oxygen species rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05415   Diabetic cardiomyopathy rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     29513 (Mapk13)    04015 Rap1 signaling pathway     29513 (Mapk13)    04370 VEGF signaling pathway     29513 (Mapk13)    04668 TNF signaling pathway     29513 (Mapk13)    04068 FoxO signaling pathway     29513 (Mapk13)    04071 Sphingolipid signaling pathway     29513 (Mapk13)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     29513 (Mapk13)   09143 Cell growth and death    04114 Oocyte meiosis     29513 (Mapk13)    04218 Cellular senescence     29513 (Mapk13)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     29513 (Mapk13)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     29513 (Mapk13)    04613 Neutrophil extracellular trap formation     29513 (Mapk13)    04620 Toll-like receptor signaling pathway     29513 (Mapk13)    04621 NOD-like receptor signaling pathway     29513 (Mapk13)    04622 RIG-I-like receptor signaling pathway     29513 (Mapk13)    04625 C-type lectin receptor signaling pathway     29513 (Mapk13)    04660 T cell receptor signaling pathway     29513 (Mapk13)    04658 Th1 and Th2 cell differentiation     29513 (Mapk13)    04659 Th17 cell differentiation     29513 (Mapk13)    04657 IL-17 signaling pathway     29513 (Mapk13)    04664 Fc epsilon RI signaling pathway     29513 (Mapk13)    04670 Leukocyte transendothelial migration     29513 (Mapk13)   09152 Endocrine system    04912 GnRH signaling pathway     29513 (Mapk13)    04914 Progesterone-mediated oocyte maturation     29513 (Mapk13)    04917 Prolactin signaling pathway     29513 (Mapk13)    04926 Relaxin signaling pathway     29513 (Mapk13)    04935 Growth hormone synthesis, secretion and action     29513 (Mapk13)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     29513 (Mapk13)   09156 Nervous system    04728 Dopaminergic synapse     29513 (Mapk13)    04723 Retrograde endocannabinoid signaling     29513 (Mapk13)    04722 Neurotrophin signaling pathway     29513 (Mapk13)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     29513 (Mapk13)   09158 Development and regeneration    04380 Osteoclast differentiation     29513 (Mapk13)   09159 Environmental adaptation    04714 Thermogenesis     29513 (Mapk13)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     29513 (Mapk13)    05208 Chemical carcinogenesis - reactive oxygen species     29513 (Mapk13)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     29513 (Mapk13)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     29513 (Mapk13)    05161 Hepatitis B     29513 (Mapk13)    05171 Coronavirus disease - COVID-19     29513 (Mapk13)    05163 Human cytomegalovirus infection     29513 (Mapk13)    05167 Kaposi sarcoma-associated herpesvirus infection     29513 (Mapk13)    05169 Epstein-Barr virus infection     29513 (Mapk13)   09171 Infectious disease: bacterial    05132 Salmonella infection     29513 (Mapk13)    05135 Yersinia infection     29513 (Mapk13)    05133 Pertussis     29513 (Mapk13)    05152 Tuberculosis     29513 (Mapk13)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     29513 (Mapk13)    05140 Leishmaniasis     29513 (Mapk13)    05142 Chagas disease     29513 (Mapk13)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     29513 (Mapk13)    05020 Prion disease     29513 (Mapk13)    05022 Pathways of neurodegeneration - multiple diseases     29513 (Mapk13)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     29513 (Mapk13)    05418 Fluid shear stress and atherosclerosis     29513 (Mapk13)    05415 Diabetic cardiomyopathy     29513 (Mapk13)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     29513 (Mapk13)    04932 Non-alcoholic fatty liver disease     29513 (Mapk13)    04933 AGE-RAGE signaling pathway in diabetic complications     29513 (Mapk13)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     29513 (Mapk13)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rno01001]     29513 (Mapk13) Enzymes [BR:rno01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      29513 (Mapk13) Protein kinases [BR:rno01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    29513 (Mapk13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  29513 NCBI-ProteinID:  NP_062104 RGD:  3045 Ensembl:  ENSRNOG00000000515 Vega:  OTTRNOG00000001972 UniProt:  Q32Q45 LinkDB All DBs Position 20:6836979..6847197 Genome browser AA seq 366 aa AA seqDB search MSLIRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF QSEIFAKRAYRELLLLKHMHHENVIGLLDVYTPATSVRNFQDFYLVMPFMQTDLQKIMGM EFSEEKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAVDLLDKMLELDVDKRLTAA QALAHPFFEPFRDPEEETEAQQPFDDALEREKLSVDEWKQHIYKEIANFSPIARKDSRRR SGMKLQ NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt atgagcctcattcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag ctgcccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggcgcggtgtgc tcggccatcgacaagcggacaggggagaaggtggccatcaagaagctgagccggcccttc cagtcggagatctttgccaagcgcgcttaccgcgaactcctgctgttgaagcacatgcac catgagaacgtcattgggcttctggatgtctacacacctgccacttccgttcgaaacttc caagatttctacctggtgatgcctttcatgcagaccgacctgcagaagataatggggatg gagttcagtgaggagaaggtccagtatttggtgtaccagatgctcaaaggtctaaagtac atccactcagctggtatcgttcacagggacctgaagccaggcaacctggccgtgaatgaa gactgtgagctgaagatcctggactttgggctggcacgccacacggacgcggagatgact ggctatgtggtgacccgctggtaccgggctcctgaggtgatcctcagctggatgcattac aaccagacggtggatatctggtctgttggctgcatcatggccgagatgctaaccggaaag acactcttcaagggtaaggactacctggaccagctgacccagatcctgaaagtgactggg gtgccaggtgccgagttcgtgcagaagctgaaagacaaggcggccaaatcctacattcag tccctgccccagagccccaagaaggatttcacacagcttttcccacgcgccagcccgcaa gctgtagacctgctggacaagatgctggagctggacgtggacaagcgtctgaccgctgct caggcactcgctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc cagcagccatttgatgatgccttagagcgggagaaactcagcgtggacgaatggaaacaa cacatctacaaagagatcgccaacttcagtcccatagcccggaaggactcgaggcgacga agtgggatgaagctgcagtga

Rattus norvegicus (rat): 60352 Help Entry 60352             CDS       T01003                                  Symbol Mapk12 Name (RefSeq) mitogen-activated protein kinase 12   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04010   MAPK signaling pathway rno04015   Rap1 signaling pathway rno04068   FoxO signaling pathway rno04071   Sphingolipid signaling pathway rno04114   Oocyte meiosis rno04148   Efferocytosis rno04218   Cellular senescence rno04261   Adrenergic signaling in cardiomyocytes rno04370   VEGF signaling pathway rno04380   Osteoclast differentiation rno04550   Signaling pathways regulating pluripotency of stem cells rno04611   Platelet activation rno04613   Neutrophil extracellular trap formation rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04625   C-type lectin receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04664   Fc epsilon RI signaling pathway rno04668   TNF signaling pathway rno04670   Leukocyte transendothelial migration rno04714   Thermogenesis rno04722   Neurotrophin signaling pathway rno04723   Retrograde endocannabinoid signaling rno04728   Dopaminergic synapse rno04750   Inflammatory mediator regulation of TRP channels rno04912   GnRH signaling pathway rno04914   Progesterone-mediated oocyte maturation rno04917   Prolactin signaling pathway rno04926   Relaxin signaling pathway rno04932   Non-alcoholic fatty liver disease rno04933   AGE-RAGE signaling pathway in diabetic complications rno04935   Growth hormone synthesis, secretion and action rno04936   Alcoholic liver disease rno05014   Amyotrophic lateral sclerosis rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05140   Leishmaniasis rno05142   Chagas disease rno05145   Toxoplasmosis rno05152   Tuberculosis rno05161   Hepatitis B rno05163   Human cytomegalovirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05205   Proteoglycans in cancer rno05208   Chemical carcinogenesis - reactive oxygen species rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05415   Diabetic cardiomyopathy rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     60352 (Mapk12)    04015 Rap1 signaling pathway     60352 (Mapk12)    04370 VEGF signaling pathway     60352 (Mapk12)    04668 TNF signaling pathway     60352 (Mapk12)    04068 FoxO signaling pathway     60352 (Mapk12)    04071 Sphingolipid signaling pathway     60352 (Mapk12)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     60352 (Mapk12)   09143 Cell growth and death    04114 Oocyte meiosis     60352 (Mapk12)    04218 Cellular senescence     60352 (Mapk12)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     60352 (Mapk12)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     60352 (Mapk12)    04613 Neutrophil extracellular trap formation     60352 (Mapk12)    04620 Toll-like receptor signaling pathway     60352 (Mapk12)    04621 NOD-like receptor signaling pathway     60352 (Mapk12)    04622 RIG-I-like receptor signaling pathway     60352 (Mapk12)    04625 C-type lectin receptor signaling pathway     60352 (Mapk12)    04660 T cell receptor signaling pathway     60352 (Mapk12)    04658 Th1 and Th2 cell differentiation     60352 (Mapk12)    04659 Th17 cell differentiation     60352 (Mapk12)    04657 IL-17 signaling pathway     60352 (Mapk12)    04664 Fc epsilon RI signaling pathway     60352 (Mapk12)    04670 Leukocyte transendothelial migration     60352 (Mapk12)   09152 Endocrine system    04912 GnRH signaling pathway     60352 (Mapk12)    04914 Progesterone-mediated oocyte maturation     60352 (Mapk12)    04917 Prolactin signaling pathway     60352 (Mapk12)    04926 Relaxin signaling pathway     60352 (Mapk12)    04935 Growth hormone synthesis, secretion and action     60352 (Mapk12)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     60352 (Mapk12)   09156 Nervous system    04728 Dopaminergic synapse     60352 (Mapk12)    04723 Retrograde endocannabinoid signaling     60352 (Mapk12)    04722 Neurotrophin signaling pathway     60352 (Mapk12)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     60352 (Mapk12)   09158 Development and regeneration    04380 Osteoclast differentiation     60352 (Mapk12)   09159 Environmental adaptation    04714 Thermogenesis     60352 (Mapk12)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     60352 (Mapk12)    05208 Chemical carcinogenesis - reactive oxygen species     60352 (Mapk12)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     60352 (Mapk12)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     60352 (Mapk12)    05161 Hepatitis B     60352 (Mapk12)    05171 Coronavirus disease - COVID-19     60352 (Mapk12)    05163 Human cytomegalovirus infection     60352 (Mapk12)    05167 Kaposi sarcoma-associated herpesvirus infection     60352 (Mapk12)    05169 Epstein-Barr virus infection     60352 (Mapk12)   09171 Infectious disease: bacterial    05132 Salmonella infection     60352 (Mapk12)    05135 Yersinia infection     60352 (Mapk12)    05133 Pertussis     60352 (Mapk12)    05152 Tuberculosis     60352 (Mapk12)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     60352 (Mapk12)    05140 Leishmaniasis     60352 (Mapk12)    05142 Chagas disease     60352 (Mapk12)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     60352 (Mapk12)    05020 Prion disease     60352 (Mapk12)    05022 Pathways of neurodegeneration - multiple diseases     60352 (Mapk12)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     60352 (Mapk12)    05418 Fluid shear stress and atherosclerosis     60352 (Mapk12)    05415 Diabetic cardiomyopathy     60352 (Mapk12)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     60352 (Mapk12)    04932 Non-alcoholic fatty liver disease     60352 (Mapk12)    04933 AGE-RAGE signaling pathway in diabetic complications     60352 (Mapk12)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     60352 (Mapk12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rno01001]     60352 (Mapk12) Enzymes [BR:rno01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      60352 (Mapk12) Protein kinases [BR:rno01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    60352 (Mapk12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Haspin_kinase UvrD_C Kinase-like Motif Other DBs NCBI-GeneID:  60352 NCBI-ProteinID:  NP_068514 RGD:  70975 Ensembl:  ENSRNOG00000031233 UniProt:  Q63538 A6K7K1 LinkDB All DBs Position 7:complement(122085647..122096307) Genome browser AA seq 367 aa AA seqDB search MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK VTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLEKMLVLDAEQRV TAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR VPKETAL NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc tgggaggtgcgcgccgtgtaccaggacctgcagcccgttggctctggtgcctatggtgca gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac atgcgccacgagaacgtcattgggctgctggatgtgttcactcccgatgagactctggat gacttcacagacttctacctggtgatgccattcatgggcactgacctgggcaagctcatg aagcacgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaagggg ctgaagtatatccacgctgccggcgtcatccacagggacttgaaacctggaaacctggct gtgaacgaggactgtgagctgaagatcctagattttggccttgccaggcaggcggacagt gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg atgcgttacacacagacagtggacatttggtctgttggctgcatcatggcagagatgatt actggaaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaaa gtcacagggacaccccctcctgagtttgtacagaagctacagagtgctgaggccaagaac tacatggaaggcctccctgagttggaaaagaaggattttgcttctgtcctgaccaatgca agccctcaggccgtgaatctcctggaaaagatgctggtgttggatgcggaacagcgggtg acagcagctgaggcattagcccacccatactttgagtcccttcgggacactgaggatgag cccaaggcccagaaatatgatgactcctttgatgacgtagaccgcacccttgaggaatgg aagcgtgttacgtataaggaagtgctcagcttcaagcctcccaggcagctaggagccaga gttccaaaggagacagctctgtga

Rattus norvegicus (rat): 689314 Help Entry 689314            CDS       T01003                                  Symbol Mapk11 Name (RefSeq) mitogen-activated protein kinase 11   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04010   MAPK signaling pathway rno04015   Rap1 signaling pathway rno04068   FoxO signaling pathway rno04071   Sphingolipid signaling pathway rno04114   Oocyte meiosis rno04148   Efferocytosis rno04218   Cellular senescence rno04261   Adrenergic signaling in cardiomyocytes rno04370   VEGF signaling pathway rno04380   Osteoclast differentiation rno04550   Signaling pathways regulating pluripotency of stem cells rno04611   Platelet activation rno04613   Neutrophil extracellular trap formation rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04625   C-type lectin receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04664   Fc epsilon RI signaling pathway rno04668   TNF signaling pathway rno04670   Leukocyte transendothelial migration rno04714   Thermogenesis rno04722   Neurotrophin signaling pathway rno04723   Retrograde endocannabinoid signaling rno04728   Dopaminergic synapse rno04750   Inflammatory mediator regulation of TRP channels rno04912   GnRH signaling pathway rno04914   Progesterone-mediated oocyte maturation rno04917   Prolactin signaling pathway rno04926   Relaxin signaling pathway rno04932   Non-alcoholic fatty liver disease rno04933   AGE-RAGE signaling pathway in diabetic complications rno04935   Growth hormone synthesis, secretion and action rno04936   Alcoholic liver disease rno05014   Amyotrophic lateral sclerosis rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05140   Leishmaniasis rno05142   Chagas disease rno05145   Toxoplasmosis rno05152   Tuberculosis rno05161   Hepatitis B rno05163   Human cytomegalovirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05205   Proteoglycans in cancer rno05208   Chemical carcinogenesis - reactive oxygen species rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05415   Diabetic cardiomyopathy rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     689314 (Mapk11)    04015 Rap1 signaling pathway     689314 (Mapk11)    04370 VEGF signaling pathway     689314 (Mapk11)    04668 TNF signaling pathway     689314 (Mapk11)    04068 FoxO signaling pathway     689314 (Mapk11)    04071 Sphingolipid signaling pathway     689314 (Mapk11)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     689314 (Mapk11)   09143 Cell growth and death    04114 Oocyte meiosis     689314 (Mapk11)    04218 Cellular senescence     689314 (Mapk11)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     689314 (Mapk11)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     689314 (Mapk11)    04613 Neutrophil extracellular trap formation     689314 (Mapk11)    04620 Toll-like receptor signaling pathway     689314 (Mapk11)    04621 NOD-like receptor signaling pathway     689314 (Mapk11)    04622 RIG-I-like receptor signaling pathway     689314 (Mapk11)    04625 C-type lectin receptor signaling pathway     689314 (Mapk11)    04660 T cell receptor signaling pathway     689314 (Mapk11)    04658 Th1 and Th2 cell differentiation     689314 (Mapk11)    04659 Th17 cell differentiation     689314 (Mapk11)    04657 IL-17 signaling pathway     689314 (Mapk11)    04664 Fc epsilon RI signaling pathway     689314 (Mapk11)    04670 Leukocyte transendothelial migration     689314 (Mapk11)   09152 Endocrine system    04912 GnRH signaling pathway     689314 (Mapk11)    04914 Progesterone-mediated oocyte maturation     689314 (Mapk11)    04917 Prolactin signaling pathway     689314 (Mapk11)    04926 Relaxin signaling pathway     689314 (Mapk11)    04935 Growth hormone synthesis, secretion and action     689314 (Mapk11)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     689314 (Mapk11)   09156 Nervous system    04728 Dopaminergic synapse     689314 (Mapk11)    04723 Retrograde endocannabinoid signaling     689314 (Mapk11)    04722 Neurotrophin signaling pathway     689314 (Mapk11)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     689314 (Mapk11)   09158 Development and regeneration    04380 Osteoclast differentiation     689314 (Mapk11)   09159 Environmental adaptation    04714 Thermogenesis     689314 (Mapk11)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     689314 (Mapk11)    05208 Chemical carcinogenesis - reactive oxygen species     689314 (Mapk11)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     689314 (Mapk11)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     689314 (Mapk11)    05161 Hepatitis B     689314 (Mapk11)    05171 Coronavirus disease - COVID-19     689314 (Mapk11)    05163 Human cytomegalovirus infection     689314 (Mapk11)    05167 Kaposi sarcoma-associated herpesvirus infection     689314 (Mapk11)    05169 Epstein-Barr virus infection     689314 (Mapk11)   09171 Infectious disease: bacterial    05132 Salmonella infection     689314 (Mapk11)    05135 Yersinia infection     689314 (Mapk11)    05133 Pertussis     689314 (Mapk11)    05152 Tuberculosis     689314 (Mapk11)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     689314 (Mapk11)    05140 Leishmaniasis     689314 (Mapk11)    05142 Chagas disease     689314 (Mapk11)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     689314 (Mapk11)    05020 Prion disease     689314 (Mapk11)    05022 Pathways of neurodegeneration - multiple diseases     689314 (Mapk11)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     689314 (Mapk11)    05418 Fluid shear stress and atherosclerosis     689314 (Mapk11)    05415 Diabetic cardiomyopathy     689314 (Mapk11)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     689314 (Mapk11)    04932 Non-alcoholic fatty liver disease     689314 (Mapk11)    04933 AGE-RAGE signaling pathway in diabetic complications     689314 (Mapk11)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     689314 (Mapk11)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rno01001]     689314 (Mapk11) Enzymes [BR:rno01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      689314 (Mapk11) Protein kinases [BR:rno01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    689314 (Mapk11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Motif Other DBs NCBI-GeneID:  689314 NCBI-ProteinID:  NP_001103002 RGD:  1309340 Ensembl:  ENSRNOG00000006984 UniProt:  A0A0G2KB06 A6K7K4 LinkDB All DBs Position 7:complement(122098120..122105023) Genome browser AA seq 364 aa AA seqDB search MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAVDLLGRMLVLDSDQRVSAA EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLETSQLPGTH EIEQ NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg ccgcagcggctgcagggcctacgcccggtgggctccggcgcctacggctcggtctgttcg gcctacgacgcacggctgcgccagaaggtggctgtgaagaagctgtctcgccctttccaa tcgctgatccacgcgaggaggacataccgtgagctacgcctactcaaacacctgaagcac gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc gaagtgtacctcgtgaccaccctgatgggcgctgacctgaataacatcgtcaagtgtcag gccctgagcgatgagcatgttcagttccttgtctaccagctgctgcgtgggctgaagtat atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcagtgaatgag gactgcgagctgaggatcctggactttgggctggcacgccaggctgatgaggagatgact ggatatgtggccacacggtggtaccgggctccagagatcatgctgaactggatgcactac aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccaaggaaag gccctctttcctggaaatgactacatcgaccagctgaagcggatcatggaggtggtgggc acacccagccctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggggccaaccctctg gctgtagacctccttggaagaatgctggtgctagacagtgaccagagagtcagtgcggcc gaagccttggcccatgcatacttcagccagtaccatgaccctgacgacgagccagaggcc gagccctatgatgaaagtgttgaggccaaggagcgcaccctggaggagtggaaggagctt acttaccaggaagtccttagcttcaagcccctggaaacatcgcagctccctggcacccat gaaattgagcagtga

Rattus norvegicus (rat): 81649 Help Entry 81649             CDS       T01003                                  Symbol Mapk14 Name (RefSeq) mitogen-activated protein kinase 14   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04010   MAPK signaling pathway rno04015   Rap1 signaling pathway rno04068   FoxO signaling pathway rno04071   Sphingolipid signaling pathway rno04114   Oocyte meiosis rno04148   Efferocytosis rno04218   Cellular senescence rno04261   Adrenergic signaling in cardiomyocytes rno04370   VEGF signaling pathway rno04380   Osteoclast differentiation rno04550   Signaling pathways regulating pluripotency of stem cells rno04611   Platelet activation rno04613   Neutrophil extracellular trap formation rno04620   Toll-like receptor signaling pathway rno04621   NOD-like receptor signaling pathway rno04622   RIG-I-like receptor signaling pathway rno04625   C-type lectin receptor signaling pathway rno04657   IL-17 signaling pathway rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04664   Fc epsilon RI signaling pathway rno04668   TNF signaling pathway rno04670   Leukocyte transendothelial migration rno04714   Thermogenesis rno04722   Neurotrophin signaling pathway rno04723   Retrograde endocannabinoid signaling rno04728   Dopaminergic synapse rno04750   Inflammatory mediator regulation of TRP channels rno04912   GnRH signaling pathway rno04914   Progesterone-mediated oocyte maturation rno04917   Prolactin signaling pathway rno04926   Relaxin signaling pathway rno04932   Non-alcoholic fatty liver disease rno04933   AGE-RAGE signaling pathway in diabetic complications rno04935   Growth hormone synthesis, secretion and action rno04936   Alcoholic liver disease rno05014   Amyotrophic lateral sclerosis rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05133   Pertussis rno05135   Yersinia infection rno05140   Leishmaniasis rno05142   Chagas disease rno05145   Toxoplasmosis rno05152   Tuberculosis rno05161   Hepatitis B rno05163   Human cytomegalovirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05169   Epstein-Barr virus infection rno05170   Human immunodeficiency virus 1 infection rno05171   Coronavirus disease - COVID-19 rno05205   Proteoglycans in cancer rno05208   Chemical carcinogenesis - reactive oxygen species rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05415   Diabetic cardiomyopathy rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     81649 (Mapk14)    04015 Rap1 signaling pathway     81649 (Mapk14)    04370 VEGF signaling pathway     81649 (Mapk14)    04668 TNF signaling pathway     81649 (Mapk14)    04068 FoxO signaling pathway     81649 (Mapk14)    04071 Sphingolipid signaling pathway     81649 (Mapk14)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     81649 (Mapk14)   09143 Cell growth and death    04114 Oocyte meiosis     81649 (Mapk14)    04218 Cellular senescence     81649 (Mapk14)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     81649 (Mapk14)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     81649 (Mapk14)    04613 Neutrophil extracellular trap formation     81649 (Mapk14)    04620 Toll-like receptor signaling pathway     81649 (Mapk14)    04621 NOD-like receptor signaling pathway     81649 (Mapk14)    04622 RIG-I-like receptor signaling pathway     81649 (Mapk14)    04625 C-type lectin receptor signaling pathway     81649 (Mapk14)    04660 T cell receptor signaling pathway     81649 (Mapk14)    04658 Th1 and Th2 cell differentiation     81649 (Mapk14)    04659 Th17 cell differentiation     81649 (Mapk14)    04657 IL-17 signaling pathway     81649 (Mapk14)    04664 Fc epsilon RI signaling pathway     81649 (Mapk14)    04670 Leukocyte transendothelial migration     81649 (Mapk14)   09152 Endocrine system    04912 GnRH signaling pathway     81649 (Mapk14)    04914 Progesterone-mediated oocyte maturation     81649 (Mapk14)    04917 Prolactin signaling pathway     81649 (Mapk14)    04926 Relaxin signaling pathway     81649 (Mapk14)    04935 Growth hormone synthesis, secretion and action     81649 (Mapk14)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     81649 (Mapk14)   09156 Nervous system    04728 Dopaminergic synapse     81649 (Mapk14)    04723 Retrograde endocannabinoid signaling     81649 (Mapk14)    04722 Neurotrophin signaling pathway     81649 (Mapk14)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     81649 (Mapk14)   09158 Development and regeneration    04380 Osteoclast differentiation     81649 (Mapk14)   09159 Environmental adaptation    04714 Thermogenesis     81649 (Mapk14)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     81649 (Mapk14)    05208 Chemical carcinogenesis - reactive oxygen species     81649 (Mapk14)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     81649 (Mapk14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     81649 (Mapk14)    05161 Hepatitis B     81649 (Mapk14)    05171 Coronavirus disease - COVID-19     81649 (Mapk14)    05163 Human cytomegalovirus infection     81649 (Mapk14)    05167 Kaposi sarcoma-associated herpesvirus infection     81649 (Mapk14)    05169 Epstein-Barr virus infection     81649 (Mapk14)   09171 Infectious disease: bacterial    05132 Salmonella infection     81649 (Mapk14)    05135 Yersinia infection     81649 (Mapk14)    05133 Pertussis     81649 (Mapk14)    05152 Tuberculosis     81649 (Mapk14)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     81649 (Mapk14)    05140 Leishmaniasis     81649 (Mapk14)    05142 Chagas disease     81649 (Mapk14)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     81649 (Mapk14)    05020 Prion disease     81649 (Mapk14)    05022 Pathways of neurodegeneration - multiple diseases     81649 (Mapk14)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     81649 (Mapk14)    05418 Fluid shear stress and atherosclerosis     81649 (Mapk14)    05415 Diabetic cardiomyopathy     81649 (Mapk14)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     81649 (Mapk14)    04932 Non-alcoholic fatty liver disease     81649 (Mapk14)    04933 AGE-RAGE signaling pathway in diabetic complications     81649 (Mapk14)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     81649 (Mapk14)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rno01001]     81649 (Mapk14) Enzymes [BR:rno01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      81649 (Mapk14) Protein kinases [BR:rno01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    81649 (Mapk14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Motif Other DBs NCBI-GeneID:  81649 NCBI-ProteinID:  NP_112282 RGD:  70496 Ensembl:  ENSRNOG00000000513 Vega:  OTTRNOG00000001971 UniProt:  A8C151 Q56A33 LinkDB All DBs Position 20:6751288..6812294 Genome browser AA seq 360 aa AA seqDB search MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccgtctgggaggtg cccgagcgataccagaacctgtccccggtgggctcgggagcctacggctcggtgtgtgct gcttttgatacaaagacgggacatcgtgtggcagtgaagaagctgtcgagaccgtttcag tccatcattcacgccaaaaggacctacagggagctgcggctgctgaagcacatgaagcac gagaatgtgattggtctgttggatgtgtttacacctgcaaggtccctggaggaattcaac gatgtgtacctggtgacccatctcatgggggcagacctgaacaacatcgtgaagtgtcag aagcttaccgatgaccacgttcagtttcttatctaccagatcctgcgagggctgaagtat atacactcggctgacataatccacagggacctaaagcccagcaacctcgctgtgaatgaa gactgtgagctgaagattctggattttgggctggctcggcacactgatgacgaaatgacc ggctacgtggctacccggtggtacagagcccccgagattatgctgaattggatgcactac aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga acgttgtttcctggtacagaccatattaaccagcttcagcagataatgcgtctgacgggg acaccccctgcttatctcattaacaggatgccaagccatgaggcaagaaactacattcag tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg gctgtcgacctgctggaaaagatgctggttttggactcggataagaggatcacagcagcc caagctcttgcgcatgcctactttgctcagtaccacgaccctgatgatgagccagtggct gacccttatgaccagtcctttgaaagcagggacctccttatagacgaatggaagagcctg acctacgatgaagtcattagctttgtgccaccgccccttgaccaagaagaaatggagtcc tga

DBGET integrated database retrieval system