Rattus norvegicus (rat): 29675 Help Entry 29675             CDS       T01003                                  Symbol Psmb2 Name (RefSeq) proteasome subunit beta type-2   KO K02734   20S proteasome subunit beta 4 [EC:3.4.25.1] Organism rno  Rattus norvegicus (rat) Pathway rno03050   Proteasome rno05010   Alzheimer disease rno05012   Parkinson disease rno05014   Amyotrophic lateral sclerosis rno05016   Huntington disease rno05017   Spinocerebellar ataxia rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     29675 (Psmb2)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     29675 (Psmb2)    05012 Parkinson disease     29675 (Psmb2)    05014 Amyotrophic lateral sclerosis     29675 (Psmb2)    05016 Huntington disease     29675 (Psmb2)    05017 Spinocerebellar ataxia     29675 (Psmb2)    05020 Prion disease     29675 (Psmb2)    05022 Pathways of neurodegeneration - multiple diseases     29675 (Psmb2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:rno01002]     29675 (Psmb2)   09182 Protein families: genetic information processing    03051 Proteasome [BR:rno03051]     29675 (Psmb2) Enzymes [BR:rno01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      29675 (Psmb2) Peptidases and inhibitors [BR:rno01002]  Threonine peptidases   Family T1: proteasome family    29675 (Psmb2) Proteasome [BR:rno03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     29675 (Psmb2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome WSLR Motif Other DBs NCBI-GeneID:  29675 NCBI-ProteinID:  NP_058980 RGD:  61874 Ensembl:  ENSRNOG00000011463 UniProt:  P40307 A6ISB2 Structure PDBPDBj LinkDB All DBs Position 5:144255058..144287200 Genome browser AA seq 201 aa AA seqDB search MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV RVIDKDGIHNLENITFTKRSS NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggagtacctcattggcatccagggtcctgactatgtcctggtcgcttctgatcgggtg gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa aaaatcttactcctatgtgttggagaggctggagacactgtacagtttgcagaatatatc cagaaaaacgtgcagctttataaaatgcggaatggatatgaattgtcccccacagcagca gctaatttcacacgccgaaacctggccgactgtcttcggagtcggaccccttatcatgtg aacctcctcctggctggctatgacgagcatgaggggccagcactttactacatggactac ctagcagccttggccaaggctccttttgcagctcatggctatggtgccttcctgaccctc agcatccttgaccgatactacacaccaactatctcacgtgagagggcagtggagcttctt aggaagtgtctggaggagctccagaagcgcttcatcttgaatctgcccaccttcagcgtt cgggtcattgacaaagatggcatccacaatctggagaacattaccttcactaagcggagt tcctaa

DBGET integrated database retrieval system