Rattus norvegicus (rat): 29676 Help Entry 29676             CDS       T01003                                  Symbol Psmb3 Name (RefSeq) proteasome subunit beta type-3   KO K02735   20S proteasome subunit beta 3 [EC:3.4.25.1] Organism rno  Rattus norvegicus (rat) Pathway rno03050   Proteasome rno05010   Alzheimer disease rno05012   Parkinson disease rno05014   Amyotrophic lateral sclerosis rno05016   Huntington disease rno05017   Spinocerebellar ataxia rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     29676 (Psmb3)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     29676 (Psmb3)    05012 Parkinson disease     29676 (Psmb3)    05014 Amyotrophic lateral sclerosis     29676 (Psmb3)    05016 Huntington disease     29676 (Psmb3)    05017 Spinocerebellar ataxia     29676 (Psmb3)    05020 Prion disease     29676 (Psmb3)    05022 Pathways of neurodegeneration - multiple diseases     29676 (Psmb3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:rno01002]     29676 (Psmb3)   09182 Protein families: genetic information processing    03051 Proteasome [BR:rno03051]     29676 (Psmb3) Enzymes [BR:rno01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      29676 (Psmb3) Peptidases and inhibitors [BR:rno01002]  Threonine peptidases   Family T1: proteasome family    29676 (Psmb3) Proteasome [BR:rno03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     29676 (Psmb3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome Motif Other DBs NCBI-GeneID:  29676 NCBI-ProteinID:  NP_058981 RGD:  61875 Ensembl:  ENSRNOG00000052730 UniProt:  P40112 A6HIL9 Structure PDBPDBj LinkDB All DBs Position 10:83193787..83200883 Genome browser AA seq 205 aa AA seqDB search MSVMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtctgttatgtcctataatggaggggccgtcatggccatgaagggaaagaactgtgtg gccatcgctgcagacaggcgtttcggaatccaggcccaaatggtgaccacggacttccag aagatctttcccatgggtgacaggctctacataggcctggccggcctggccactgacgtc cagacagttgcccagcgtctcaagttccgactgaacctgtacgagctgaaggaaggacgg cagatcaagccttacaccctgatgagcatggtggccaacctcttgtatgagaaacggttt ggtccctactacacagaacctgtcattgctggcttggacccgaagacctttaagcccttc atttgctctctggacctcattggctgtcccatggtgacagatgacttcgtagtcagtggc acctgctctgaacaaatgtatgggatgtgtgagtctctctgggagcccaacatggatcca gagcacctgtttgagaccatttctcaggccatgctgaatgctgtggacagggatgccgtg tcgggcatgggcgtcattgtccacatcattgaaaaagacaagatcaccaccaggacactg aaggcgcggatggactaa

DBGET integrated database retrieval system