KEGG   Rattus norvegicus (rat): 29722
Entry
29722             CDS       T01003                                 
Symbol
Apbb1
Name
(RefSeq) amyloid-beta A4 precursor protein-binding family B member 1
  KO
K04529  amyloid beta A4 precursor protein-binding family B member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29722 (Apbb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29722 (Apbb1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    29722 (Apbb1)
SSDB
Motif
Pfam: PID WW PTB
Other DBs
NCBI-GeneID: 29722
NCBI-ProteinID: NP_536726
RGD: 2122
Ensembl: ENSRNOG00000018020
UniProt: P46933
LinkDB
Position
1:complement(159896889..159920505)
AA seq 711 aa
MSVPSSLSQSAINANSHGGPALSFPFPLHAAHNQLLNAKLQATAVVPKDLRSAMGEGSVP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEAETAPLGPKGLMHLYSEL
ELSAHNAANRGLHGSALIINTQGLGPDEGEEKAAGEVEEEDEDEEEEDEEEEDLSSPQGL
PEPLENVEVPSGPQVLTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPED
TDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGNSPQEESQ
LTWTGFAHQEGFEEGEFWKDEPSEEAPMELGLKDPEEGTLPFSAQSLSPEPVPQEEENLP
QRNANPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEG
KDLLLQLEDETLKLVEPQNQTLLHAQPIVSIRVWGVGRDSGRERDFAYVARDKLTQMLKC
HVFRCEAPAKNIATSLHEICSKIMSERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNEL
VQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEA
VLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQ
KCLDARSQTSTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGSQTP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgtctgttccatcatccctgagccagtcggccattaatgctaacagccacggaggccct
gcactcagcttccccttccccttgcatgctgcccataaccagctgctcaacgccaagctg
caagccacagctgtggtacccaaggaccttcgaagtgccatgggagagggtagtgtgcct
gaaccaggccctgccaatgccaagtggttaaaggaaggccagaaccagcttcggagggct
gccacagcccatcgagaccagaaccgaaatgtgaccttgaccttggcggaggaggccagc
caggaggctgagacagcacctttgggtcccaaaggcttaatgcatctatactctgagctg
gagctctcggcccacaatgcagccaaccgagggcttcatggatccgccttgatcatcaac
acccagggactgggaccagatgaaggagaggagaaggcagcaggagaagttgaggaggag
gatgaagatgaggaggaagaggatgaggaggaggaggacttgtcttctcctcaagggcta
cctgagcctctggagaatgtggaagtcccctctggaccccaggtcctcacagatggcccc
cgggaacatagcaagagtgctagcctcctatttggcatgcgaaacagtgcagccagtgac
gaggactcaagctgggccaccttatcgcagggcagcccctcctatggctctccggaggac
acagattccttctggaaccccaacgctttcgagacggattccgatctaccggctggatgg
atgagggtccaagacacctcagggacctactactggcacatcccaacagggaccacccag
tgggaacccccaggccgggcctccccatcgcaggggaacagtccccaagaagagtcccag
ctcacctggactggctttgctcaccaagaaggctttgaggaaggagagttttggaaggat
gaacctagtgaagaggccccaatggagttgggactgaaggaccctgaggaggggacattg
cccttctcagctcagagcctcagcccagagccagtgccccaggaggaggagaatctgccc
caacggaacgccaatccagggatcaagtgtttcgctgtgcgctccctaggctgggtagag
atgactgaggaggagctggccccaggacgcagcagtgtggcagtcaacaattgtatccgc
cagctctcctaccacaaaaacaatctacatgatccgatgtctggaggctggggagaggga
aaggatctgctgctccagctggaggatgagacgctaaagttggtggagccacagaaccag
acactgctgcatgcccagcccatcgtcagcattcgcgtgtggggcgttgggcgggacagt
ggaagagagagggactttgcctacgtagctcgagataagctgacccagatgctcaagtgc
cacgtgtttcgctgtgaggcacctgccaagaacatcgccaccagcctgcatgagatctgc
tccaagatcatgtctgaacggcgcaatgctcgctgcttggtaaatggactctccctggac
cactctaaacttgtggatgtccctttccaagtggaattcccagcaccaaagaatgaactg
gtgcagaagtttcaagtctattacctagggaacgtgcctgtggctaaacccgttggggta
gatgtgattaatggagccctggagtcagtcctgtcttccagtagtcgtgagcagtggacc
ccaagtcacgtcagcgtggcccctgccaccctcaccatcttgcaccagcagacagaagca
gtgctgggggagtgtcgagtgcggttcctctccttcctggctgtgggcagagatgtgcac
acgttcgcattcatcatggctgccggcccagcctccttctgctgtcacatgttttggtgc
gagcccaatgctgccagtctctcggaggctgtgcaggctgcatgcatgctccgctaccag
aagtgtctggatgctcgttcccagacctccacctcctgcctcccagcaccccctgcggag
tcagttgcgagacgtgtagggtggactgtccgcaggggtgttcagtctctgtggggttcc
ctcaagcccaaacgtctaggatcccagaccccatga

DBGET integrated database retrieval system