Rattus norvegicus (rat): 29749 Help Entry 29749             CDS       T01003                                  Symbol Ppp3r2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism rno  Rattus norvegicus (rat) Pathway rno04010   MAPK signaling pathway rno04020   Calcium signaling pathway rno04022   cGMP-PKG signaling pathway rno04114   Oocyte meiosis rno04218   Cellular senescence rno04310   Wnt signaling pathway rno04360   Axon guidance rno04370   VEGF signaling pathway rno04380   Osteoclast differentiation rno04625   C-type lectin receptor signaling pathway rno04650   Natural killer cell mediated cytotoxicity rno04658   Th1 and Th2 cell differentiation rno04659   Th17 cell differentiation rno04660   T cell receptor signaling pathway rno04662   B cell receptor signaling pathway rno04720   Long-term potentiation rno04724   Glutamatergic synapse rno04921   Oxytocin signaling pathway rno04922   Glucagon signaling pathway rno04924   Renin secretion rno05010   Alzheimer disease rno05014   Amyotrophic lateral sclerosis rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05031   Amphetamine addiction rno05152   Tuberculosis rno05163   Human cytomegalovirus infection rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05170   Human immunodeficiency virus 1 infection rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer rno05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     29749 (Ppp3r2)    04310 Wnt signaling pathway     29749 (Ppp3r2)    04370 VEGF signaling pathway     29749 (Ppp3r2)    04020 Calcium signaling pathway     29749 (Ppp3r2)    04022 cGMP-PKG signaling pathway     29749 (Ppp3r2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     29749 (Ppp3r2)    04218 Cellular senescence     29749 (Ppp3r2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     29749 (Ppp3r2)    04650 Natural killer cell mediated cytotoxicity     29749 (Ppp3r2)    04660 T cell receptor signaling pathway     29749 (Ppp3r2)    04658 Th1 and Th2 cell differentiation     29749 (Ppp3r2)    04659 Th17 cell differentiation     29749 (Ppp3r2)    04662 B cell receptor signaling pathway     29749 (Ppp3r2)   09152 Endocrine system    04922 Glucagon signaling pathway     29749 (Ppp3r2)    04921 Oxytocin signaling pathway     29749 (Ppp3r2)    04924 Renin secretion     29749 (Ppp3r2)   09156 Nervous system    04724 Glutamatergic synapse     29749 (Ppp3r2)    04720 Long-term potentiation     29749 (Ppp3r2)   09158 Development and regeneration    04360 Axon guidance     29749 (Ppp3r2)    04380 Osteoclast differentiation     29749 (Ppp3r2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     29749 (Ppp3r2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     29749 (Ppp3r2)    05170 Human immunodeficiency virus 1 infection     29749 (Ppp3r2)    05163 Human cytomegalovirus infection     29749 (Ppp3r2)    05167 Kaposi sarcoma-associated herpesvirus infection     29749 (Ppp3r2)   09171 Infectious disease: bacterial    05152 Tuberculosis     29749 (Ppp3r2)   09164 Neurodegenerative disease    05010 Alzheimer disease     29749 (Ppp3r2)    05014 Amyotrophic lateral sclerosis     29749 (Ppp3r2)    05020 Prion disease     29749 (Ppp3r2)    05022 Pathways of neurodegeneration - multiple diseases     29749 (Ppp3r2)   09165 Substance dependence    05031 Amphetamine addiction     29749 (Ppp3r2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     29749 (Ppp3r2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rno01009]     29749 (Ppp3r2) Protein phosphatases and associated proteins [BR:rno01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      29749 (Ppp3r2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 IL1_propep Motif Other DBs NCBI-GeneID:  29749 NCBI-ProteinID:  NP_067733 RGD:  69232 UniProt:  P28470 A6KJD5 LinkDB All DBs Position 5:complement(68822387..68823382) Genome browser AA seq 176 aa AA seqDB search MGNEASYHSEMGTHFDHDEIKRLGRSFKKMDLDKSGSLSVDEFMSLPELQQNPLVGRVID IFDTDGNGEVDFREFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFRDVVRTMEIHKKLVVFVDHGQED NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttaccattctgagatgggcacccacttcgaccacgacgagatt aaaaggctgggcagaagcttcaagaagatggacttggacaaatcgggctccctgagcgta gacgagttcatgtcgctgcctgagctgcagcagaatccactggtgggccgagtgatcgac atctttgacacagacggcaacggggaagtggacttccgcgagttcatcgtgggcacctcc cagttcagcgtcaagggtgacgaagagcagaagctaaggttcgccttcagaatctatgac atggataatgatggcttcatctccaacggggagctcttccaggtgcttaagatgatggtg ggaaacaacctcaaggactggcagctgcagcagctggtggacaaaagcatcttggtcctg gataaggatggtgatggccggatatcctttgaagagttccgtgatgtggtcagaaccatg gagatccacaagaaattggtcgtgtttgtagatcacggtcaagaagactaa

DBGET integrated database retrieval system