Rattus norvegicus (rat): 302783 Help Entry 302783            CDS       T01003                                  Symbol H2ab3 Name (RefSeq) H2A.B variant histone 3   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     302783 (H2ab3)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     302783 (H2ab3)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     302783 (H2ab3)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     302783 (H2ab3)   09165 Substance dependence    05034 Alcoholism     302783 (H2ab3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     302783 (H2ab3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     302783 (H2ab3) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     302783 (H2ab3) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    302783 (H2ab3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  302783 NCBI-ProteinID:  NP_001100439 RGD:  1561666 Ensembl:  ENSRNOG00000029736 UniProt:  D4ACM0 A6IVB5 LinkDB All DBs Position X:86566994..86567568 Genome browser AA seq 116 aa AA seqDB search MPRTTENSLRGSSSRRRRRSRTSRAELIFAVSLVEQHLREGGHARRRLSETVPIFLAAIL EFLTRRLLELAGNEAQRRGTQSRITPELLDLAVYSNTLLSELFQFITISRVAPAHH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcccaggaccacggagaacagtcttcgaggttcctcatctcgtcgccgccgtcgctcc cgcacctcaagagccgagctgatctttgccgtgagcctggtggaacaacatctgagggaa ggcggccatgcccggaggaggctgagtgaaacggtgcccattttcctggcagccatcctg gagttcctcacccgcaggctgctggagctggcaggcaatgaagcccaacgaagaggtacc cagagccgcatcactccggagctgctggacttggcagtctacagcaataccctgctcagc gaattgttccaattcatcaccatctcacgggtggctccagctcatcactag

DBGET integrated database retrieval system