Rattus norvegicus (rat): 304407 Help Entry 304407            CDS       T01003                                  Symbol Cldn4 Name (RefSeq) claudin-4   KO K06087   claudin Organism rno  Rattus norvegicus (rat) Pathway rno03272   Virion - Hepatitis viruses rno04382   Cornified envelope formation rno04514   Cell adhesion molecules rno04530   Tight junction rno04670   Leukocyte transendothelial migration rno05160   Hepatitis C Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     304407 (Cldn4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     304407 (Cldn4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     304407 (Cldn4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     304407 (Cldn4)   09158 Development and regeneration    04382 Cornified envelope formation     304407 (Cldn4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     304407 (Cldn4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:rno03037]     304407 (Cldn4)    04147 Exosome [BR:rno04147]     304407 (Cldn4)    04515 Cell adhesion molecules [BR:rno04515]     304407 (Cldn4) Cilium and associated proteins [BR:rno03037]  Other cilia and associated proteins   Stereociliary proteins    304407 (Cldn4) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    304407 (Cldn4)   Exosomal proteins of colorectal cancer cells    304407 (Cldn4) Cell adhesion molecules [BR:rno04515]  Immunoglobulin superfamily   L1 family    304407 (Cldn4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl Motif Other DBs NCBI-GeneID:  304407 NCBI-ProteinID:  NP_001012022 RGD:  1307932 Ensembl:  ENSRNOG00000001476 UniProt:  Q5XIT8 F7FBN1 LinkDB All DBs Position 12:27388160..27389958 Genome browser AA seq 210 aa AA seqDB search MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMIT AGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGL LCCNCPPRRNEKPYSAKYSAARSVPASNYV NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggcgtccatggggctgcaggtgctgggaatctccttggccgtcctgggctggttagga gtcatcctgagttgttcgctccccatgtggcgggtgaccgccttcatcggcagcaacatc gtcacggcgcagacgagctgggaaggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaagatgtacgactcgatgctggccctgccgcaggacctgcaggccgcc cgagccctgatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtcgta gggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaaggtcatgatcaca gccggagccgtgttcatcgtggcaagcatgctgattatggtgcctgtgtcctggacggca cacaacgtcatccgcgacttctacaaccctctggtggcttccgggcagaaaagggagatg ggggcctcgctttacatcggctgggcggcttctgggctgctgctcctgggaggaggcctc ctctgctgcaattgcccacctcgccgcaacgaaaagccctactccgccaagtactccgcc gcccgctctgttcccgccagcaactatgtgtaa

DBGET integrated database retrieval system