KEGG   Rattus norvegicus (rat): 308267
Entry
308267            CDS       T01003                                 
Symbol
Tab2
Name
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    308267 (Tab2)
   04064 NF-kappa B signaling pathway
    308267 (Tab2)
   04668 TNF signaling pathway
    308267 (Tab2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    308267 (Tab2)
   04621 NOD-like receptor signaling pathway
    308267 (Tab2)
   04657 IL-17 signaling pathway
    308267 (Tab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    308267 (Tab2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    308267 (Tab2)
   05161 Hepatitis B
    308267 (Tab2)
   05171 Coronavirus disease - COVID-19
    308267 (Tab2)
   05162 Measles
    308267 (Tab2)
   05168 Herpes simplex virus 1 infection
    308267 (Tab2)
   05169 Epstein-Barr virus infection
    308267 (Tab2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    308267 (Tab2)
   05135 Yersinia infection
    308267 (Tab2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    308267 (Tab2)
   05140 Leishmaniasis
    308267 (Tab2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    308267 (Tab2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    308267 (Tab2)
SSDB
Motif
Pfam: CUE Spc29 DivIC HIP1_clath_bdg
Other DBs
NCBI-GeneID: 308267
NCBI-ProteinID: NP_001012062
RGD: 1309527
Ensembl: ENSRNOG00000016054
UniProt: Q5U303
LinkDB
Position
1:complement(2375026..2424759)
AA seq 627 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDESGISGLRNHMTSLNLDLQSQNVYHHGREGSRVNGSRTLTHSVSDGQLQGGQSNNE
LFQQEPQTAPAQVPQGFNVFGMPSTSGASNSTPHLGFHLGSKGTSNLSQQTPRFNPIMVT
LAPNIQTGRSTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPSGAARQTQQHSGWVSQFN
PVNPQQAYQPSQPGPWTTYPASNPLPHTSTQQPNQQGHQTSHVYMPISSPTTPQPPTVHS
SASSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTASTSSLVNSQTL
NRNQPTVYIAASPPSTDEMISRSQPKVYISANASTGDEQGMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRVLGGNSAASPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETETIQHLTDPTLAHVDRVSEARKLSMGSDDAAYTQALLVHQ
KARMERLQRELEMQKKKLDKLKSEVNEMENSLTRRRLKRSNSMSQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGKVQCILS
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaagttc
cctgaagtgcctgaagttgttgtatccaggtgcatgttacagaacaataataacctggat
gcctgctgtgctgttctctctcaggagagtacaaggtatctttacggtgaaggagacctg
aatttttcagatgagtctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcagtcacagaatgtttaccaccatggaagagaaggaagtcgagtgaacggaagt
aggactttaacacacagtgttagcgatggacagcttcaaggtgggcagtccaataacgaa
ctgtttcagcaggagccacaaacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgcccagtacatctggtgcttctaattcaacaccacatcttggatttcacctaggc
agcaaagggacatcaaacctctctcaacaaactcccaggtttaatcctattatggtaact
ttagccccaaacatacagactggccgaagcacccctacgtctttgcacatacatggtgtg
cctccacctgtactcaacagcccacaggggaattctatctacattaggccttacatcaca
actcctagtggtgcagctcgacagacacagcagcattctggctgggtatctcagtttaat
cccgtgaaccctcagcaagcctatcagccttcacagcctggaccttggactacttatcct
gcatccaatcctttgccacatacctcaacccagcagccgaatcagcagggccatcagacc
tctcatgtctacatgcctatcagttcgccaactactccacaaccgccaacagttcactcg
tctgctagctctcagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagatagaaatcaaacttgaacccccacaaagaaacagttcttcaaaa
ttacgttcttctggacctcgaactgccagcacttcctcattggtcaacagccagacctta
aatagaaatcagcccactgtttacatagctgccagtcctccaagcactgatgagatgatc
tcccgtagtcaacccaaggtctacatctcagccaatgccagcacaggagatgagcagggc
atgcggaatcagcctacactcttcatatccacgaactctggggcctctgcagcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttatccaccaccaccctcccaaaagc
cgggtgttaggtggcaactccgcagcctcccctcgagtggtggtgacgcagcccaacaca
aagtacaccttcaaaatcacagtttctcccaataagccccctgccgtctccccgggggtt
gtctcccccacctttgaacttacaaatcttctgaatcaccctgaccattatgtagaaaca
gagactattcagcacctcacagaccctactctagcacacgtggatagagtaagcgaagca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctctgctggtgcaccag
aaggccaggatggaacggcttcaaagagagctcgagatgcagaagaaaaagctggacaaa
ctcaaatctgaggtcaatgagatggaaaacagtctaacgcgaaggcgcctgaagaggtcc
aactccatgtcccagataccttcactcgaagaaatgcagcagttgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgaggt
aaagttcagtgcattctcagctga

DBGET integrated database retrieval system