KEGG   Rattus norvegicus (rat): 315139
Entry
315139            CDS       T01003                                 
Symbol
Tab1
Name
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05161  Hepatitis B
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    315139 (Tab1)
   04064 NF-kappa B signaling pathway
    315139 (Tab1)
   04668 TNF signaling pathway
    315139 (Tab1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    315139 (Tab1)
   04621 NOD-like receptor signaling pathway
    315139 (Tab1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    315139 (Tab1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    315139 (Tab1)
   05161 Hepatitis B
    315139 (Tab1)
   05168 Herpes simplex virus 1 infection
    315139 (Tab1)
   05169 Epstein-Barr virus infection
    315139 (Tab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    315139 (Tab1)
   05135 Yersinia infection
    315139 (Tab1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    315139 (Tab1)
   05140 Leishmaniasis
    315139 (Tab1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    315139 (Tab1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    315139 (Tab1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 315139
NCBI-ProteinID: NP_001103446
RGD: 1306216
Ensembl: ENSRNOG00000017285
Vega: OTTRNOG00000002107
UniProt: A0A0U1RRU5
LinkDB
Position
7:111675829..111707058
AA seq 502 aa
MAAQRRSLLQSEQQPSWTDDLPLCHFSGVGSASNRSYSADGKGTESHPPEDNWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNTEHTDADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLLPQYQKILERLKALEKEISGGAMAVVAVLLNNKLYV
ANVGTNRALLCRSTVDGLQVTQLNVDHTAENEDELFRLSQLGLDAGKIKQVGVICGQEST
RRIGDYKVKYGYTDIDLLSTAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEVAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAKFCPRHEDMTL
LVRNFGYPLGEMSQPTPTPAPGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGSH
SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYV
DFAEFYRLWSVDHGEQSVMTAP
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctccagagtgagcagcagccaagctggacagatgac
ctgccactctgtcacttctccggcgttggttcagcttccaaccgtagctactctgctgat
ggcaagggcactgagagtcaccctccggaggacaactggctcaagttcagaagtgaaaac
aactgcttcctgtatggggtcttcaatggctatgatggcaaccgcgtgaccaactttgtg
gcgcagagactctctgcagagctcctgctgggccagctcaacaccgaacacacagatgct
gatgtgcgacgggtcctgctgcaggccttcgatgtggtggagaggagcttcctggagtct
atcgatgatgccttggctgagaaagcaagcctccagtcccagctgccggagggtgtgccc
caacaccagctgctacctcagtatcagaagatcctggagagactcaaggcactggagaag
gagatctcgggaggggccatggctgttgtggcggtccttctcaacaacaagctctacgtt
gccaatgttggtacgaacagggcccttctgtgcagatccaccgtggacgggctacaggtc
acacagctgaacgtggaccacaccgccgagaatgaggacgagctcttccgtctctcacaa
ctgggtttagacgcagggaagatcaagcaggtgggcgtcatctgtggacaggagagcacc
aggcgaattggggattacaaggtcaaatatggctacactgacattgacctgctcagcact
gccaaatccaaacccatcatcgcagagcccgaaatccacggcgcacagcctctggatggc
gtgacgggcttcctggtactgatgtcggaggggctgtacaaggccctggaggcagcccat
gggcctgggcaggccaaccaggaggttgccgcaatgattgacaccgaatttgccaagcag
acctccctcgatgcagttgcccaggctgtggtagaccgtgtaaagcgtatccacagtgac
acctttgccagcggtggggagcgggccaagttctgcccacggcatgaagacatgaccctg
ctggtgaggaactttggctatccattaggtgaaatgagccagccgacacccaccccggcc
ccagggggccgtgtgtaccctgtttctgtgccctactcaagtgcccagagcaccagcaag
accagtgtgactctgtccctcgtcatgccttctcagggccagatggtcaacggctctcac
agtgcctccaccttggatgaagccactcctactctcactaaccagagccccactctgacc
ctgcagtctaccaacacccacacccagagcagcagctccagctcggacgggggcctcttc
cgctccagaccggctcactcacttccacctggagaggatggcagggtcgagccctatgtg
gactttgctgagttttaccgactctggagcgtggaccatggcgagcagagtgtgatgacg
gcaccttag

DBGET integrated database retrieval system