KEGG   Rattus norvegicus (rat): 361296
Entry
361296            CDS       T01003                                 
Symbol
Rnf125
Name
(RefSeq) E3 ubiquitin-protein ligase RNF125
  KO
K12170  E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    361296 (Rnf125)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361296 (Rnf125)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     361296 (Rnf125)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    361296 (Rnf125)
SSDB
Motif
Pfam: zf_C2HC_14 zf-C3HC4_2 zf-RING_UBOX zf-Di19 zf-C3HC4_4 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 zf-Nse zf-RING_10 Rad50_zn_hook U-box zf-RING_6 zf-rbx1 zf-RING_11 ADNP_N
Other DBs
NCBI-GeneID: 361296
NCBI-ProteinID: NP_001101894
RGD: 1306757
Ensembl: ENSRNOG00000057832
UniProt: B1WCA3
LinkDB
Position
18:12254066..12275719
AA seq 233 aa
MGSLLSSDSSKSAPTSSARRTLERSGDPELPITSFDCSVCLEVLHQPVRTRCGHVFCRSC
IATSIKNNNKWTCPYCRAYLPSEGVPATDIAKRMKSEYQNCTECGTLVCLSDMRAHIRTC
EKYIDKYGPLQELGETTARCVCPFCQRELDEDCLLDHCIIHHRSERRPVFCPLCHSQPNE
SPSTFSGSLIRHLQVSHTLFYDDFIDFDIIEEAIIRRVLDRSLLEYVNQSNTT
NT seq 702 nt   +upstreamnt  +downstreamnt
atgggctccctgctgagcagcgacagctccaagtccgctccaacctcctccgcccggcgg
actctggagcgtagcggggacccggagctgcccatcacctccttcgactgctccgtgtgc
ctggaggtgctacaccagccggtccggacccgctgtggccacgtgttctgccgctcttgc
attgcaaccagtataaagaacaataataagtggacatgcccatactgccgcgcgtacctt
ccttcagagggagtgcccgcaactgacatagccaagaggatgaagtcagaataccagaac
tgtactgagtgtggaactctggtctgcctcagtgacatgagggcgcacattaggacgtgt
gagaagtacatcgataaatatggcccactgcaagagcttggagagaccactgcaagatgc
gtgtgtccattttgtcagagagaactggatgaagactgcttgctggatcattgtattatc
caccacagatcagaaaggaggcctgtgttctgcccactttgccattcacaacccaatgaa
agcccaagtaccttcagtggcagtttaattagacatttgcaagtcagccacactttgttt
tacgacgatttcatagattttgatataattgaggaagccattattcgcagagtgttagac
cgctcgcttcttgaatatgtgaatcagtcaaacaccacataa

DBGET integrated database retrieval system