Rattus norvegicus (rat): 361568 Help Entry 361568            CDS       T01003                                  Symbol Rras Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism rno  Rattus norvegicus (rat) Pathway rno04010   MAPK signaling pathway rno04014   Ras signaling pathway rno04015   Rap1 signaling pathway rno04024   cAMP signaling pathway rno04072   Phospholipase D signaling pathway rno04137   Mitophagy - animal rno04140   Autophagy - animal rno04218   Cellular senescence rno04360   Axon guidance rno04371   Apelin signaling pathway rno04625   C-type lectin receptor signaling pathway rno04810   Regulation of actin cytoskeleton rno05132   Salmonella infection rno05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     361568 (Rras)    04014 Ras signaling pathway     361568 (Rras)    04015 Rap1 signaling pathway     361568 (Rras)    04371 Apelin signaling pathway     361568 (Rras)    04072 Phospholipase D signaling pathway     361568 (Rras)    04024 cAMP signaling pathway     361568 (Rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     361568 (Rras)    04137 Mitophagy - animal     361568 (Rras)   09143 Cell growth and death    04218 Cellular senescence     361568 (Rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     361568 (Rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     361568 (Rras)   09158 Development and regeneration    04360 Axon guidance     361568 (Rras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     361568 (Rras)   09171 Infectious disease: bacterial    05132 Salmonella infection     361568 (Rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:rno04031]     361568 (Rras) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     361568 (Rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  361568 NCBI-ProteinID:  NP_001101951 RGD:  1311443 Ensembl:  ENSRNOG00000037247 UniProt:  D3Z8L7 LinkDB All DBs Position 1:104637061..104640841 Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPRDPPPGETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGNGFLLVFAINDRQSFIEVS KLFTQILRVKDRDDFPIVLVGNKADLETQRQVLRSEASSFSASHHMTYFEASAKLRLNVD EAFEQLVRTVRKYQEQELPPSPPSAPRKKDGRCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggactgggcgggggcggccccggggcggggggccggga cccagggaccccccgcccggcgagactcacaagctggtggtcgtaggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactatgacccc accattgaggattcctacacaaagatctgcacggtggacggcatccctgcacggctggac atcctggacactgcggggcaagaggaattcggcgccatgcgggagcagtacatgcgtgct ggcaatggcttcttgctggtgtttgccattaacgacaggcagagtttcattgaagtaagc aagctcttcactcagatcctcagggtcaaggaccgcgatgacttccccattgtgctggtt gggaacaaggcagatctggagacacagcgccaggtccttcgatcagaggcctcctccttt agtgcttcccaccatatgacttactttgaggcctcagccaaactgcgtctaaatgtcgat gaggcatttgagcagctggtgcggactgtccggaaataccaggagcaagaactccctcct agcccacccagtgcccctaggaagaaggatgggaggtgcccctgtgtcctgctgtag

DBGET integrated database retrieval system