Rattus norvegicus (rat): 361698 Help Entry 361698            CDS       T01003                                  Symbol Pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism rno  Rattus norvegicus (rat) Pathway rno03030   DNA replication rno03410   Base excision repair rno03420   Nucleotide excision repair rno03430   Mismatch repair rno03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     361698 (Pold4)    03410 Base excision repair     361698 (Pold4)    03420 Nucleotide excision repair     361698 (Pold4)    03430 Mismatch repair     361698 (Pold4)    03440 Homologous recombination     361698 (Pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rno03032]     361698 (Pold4)    03400 DNA repair and recombination proteins [BR:rno03400]     361698 (Pold4) DNA replication proteins [BR:rno03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     361698 (Pold4) DNA repair and recombination proteins [BR:rno03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       361698 (Pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      361698 (Pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  361698 NCBI-ProteinID:  NP_001013213 RGD:  1308519 Ensembl:  ENSRNOG00000018765 UniProt:  F7F6Q0 Q6P6U6 LinkDB All DBs Position 1:210956110..210957863 Genome browser AA seq 107 aa AA seqDB search MGRKRFITDSYPVVKKREGPPGHNKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLKPPVEVYQVLKTHPEDSRFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggtcggaagcggttcatcacagactcctaccctgttgtgaagaagagggaggggccc cctgggcacaacaagggggagctggcacccgagctaggggaagacacccagtccctcagc caggaggaaacagagctggagttgctgaggcagtttgacctggcctggcagtatgggcct tgcacaggtatcacaaggctgcagcgctggcatcgggcagagcagatgggcttgaagccc cccgtagaggtgtaccaagtgttgaagacacatcctgaagactctcgcttccaatgcagc ctctggcatctctacccactctga

DBGET integrated database retrieval system