Rattus norvegicus (rat): 364723 Help Entry 364723            CDS       T01003                                  Symbol Hist1h2ao Name (RefSeq) histone H2A type 1-E   KO K11254   histone H4 Organism rno  Rattus norvegicus (rat) Pathway rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05203   Viral carcinogenesis rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     364723 (Hist1h2ao)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     364723 (Hist1h2ao)   09163 Immune disease    05322 Systemic lupus erythematosus     364723 (Hist1h2ao)   09165 Substance dependence    05034 Alcoholism     364723 (Hist1h2ao)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     364723 (Hist1h2ao) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     364723 (Hist1h2ao) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  364723 NCBI-ProteinID:  NP_001395688 RGD:  1304905 LinkDB All DBs Position 17:complement(47400488..47400878) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaaaggtgggaagggtctgggcaaaggcggcgctaagcgccaccgc aaagtcctgcgcgacaacatccagggcatcactaagcccgccatccgccgcctggcccgg cgcggaggagtgaagcgcatctccggcctcatctacgaggagacccgcggtgtgctgaag gtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag accgtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctaa

DBGET integrated database retrieval system