KEGG   Rattus norvegicus (rat): 365744
Entry
365744            CDS       T01003                                 

Gene name
Hnf4g
Definition
(RefSeq) hepatocyte nuclear factor 4-gamma
  KO
K08037  hepatocyte nuclear factor 4-gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    365744 (Hnf4g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    365744 (Hnf4g)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    365744 (Hnf4g)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    365744 (Hnf4g)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   365744 (Hnf4g)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 365744
NCBI-ProteinID: NP_001102409
RGD: 1310102
Ensembl: ENSRNOG00000008971
UniProt: F1M342
LinkDB
Position
2
AA seq 418 aa
MDSSAPETTSMNTTDSGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRF
SRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGTNIPSINTLAQA
EVRSCQISVPNPSASTDINVKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVA
LLRAHAGEHLLLGATKRSMMYKDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEI
QIDDNEYACLKAIVFFDPDAKGLSDPGKIKNMRFQVQISLEDYINDRQYDSRGRFGELLL
LLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLGGAANDGGHPHHPMHPHLSQDPLT
GQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEQYKITANQASVISHQPLSKQKQL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggacagttctgccccagagacaacaagtatgaataccacagacagtggtgtcaactgt
ctatgtgccatctgtggtgacagagcaacaggaaagcactatggggcatccagctgtgat
ggctgcaaaggctttttcaggcgtagcattcggaagagtcacgtttattcctgcaggttc
agtcgccagtgtgttgttgacaaggacaaaaggaatcaatgcagatactgtcgattaaga
aaatgttttagagcaggaatgaaaaaagaagcggtgcaaaatgagcgcgacagaatcagc
acaagaagaagcacgtacgagggcaccaacatcccctccatcaatactctggcacaagcc
gaagtgaggtcctgccagatctcagtcccaaaccccagcgccagcactgacataaacgtt
aagaaaattgcaagcatcagtgacgtttgtgagtccatgaagcaacagctcttagtattg
gtggaatgggccaaatacattcctgccttctgtgaattgcctttggatgaccaggtggcc
ctattgagagctcatgccggggagcacttacttcttggagctacaaagagatccatgatg
tacaaagatattttgcttctgggaaaccactacgttattcaccgcaacagctgtgaagtt
gaagtcagccgtgtggccaatagagttcttgatgagctggttagacccttccaagagatc
cagatagatgacaacgagtacgcatgcttgaaggccattgtgttttttgacccagatgca
aagggattgagtgaccctgggaagattaagaacatgcggttccaggtgcagatcagcctg
gaggactacatcaatgaccggcagtatgactcgcgcggcaggttcggagagctgctgttg
ctgctgccaacccttcagagcatcacctggcagatgatcgagcaaattcagttcgtcaaa
ctgttcggcatggtcaaaattgacaacctcctgcaggaaatgttgctgggtggtgcggcc
aatgatggtggtcatccccatcacccaatgcacccacatttgtctcaagatccactaact
gggcaaactatacttttaggtccaatgtccacactggttcatacagaccagattgccact
ccagaaaccccacttccttccccaccccaaggctctggacaagagcagtacaaaatcact
gcaaaccaagcttcagtcatttcacatcaacccctttctaagcaaaagcaactgtga

DBGET integrated database retrieval system