Rattus norvegicus (rat): 365877 Help Entry 365877            CDS       T01003                                  Symbol H2ac18 Name (RefSeq) histone H2A type 1   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     365877 (H2ac18)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     365877 (H2ac18)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     365877 (H2ac18)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     365877 (H2ac18)   09165 Substance dependence    05034 Alcoholism     365877 (H2ac18)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     365877 (H2ac18)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     365877 (H2ac18) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     365877 (H2ac18) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    365877 (H2ac18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  365877 NCBI-ProteinID:  NP_001302422 RGD:  1307165 UniProt:  P0CC09 K7S2S2 LinkDB All DBs Position 2:186497271..186497865 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc cgcgccgggctgcagttcccagtgggtcgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgccggtatacatggcggcggtgctggagtacctgacc gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaagaactcaacaagctgctgggcaaa gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acggagagccaccataaggcgaagggcaagtga

DBGET integrated database retrieval system