Rattus norvegicus (rat): 367254 Help Entry 367254            CDS       T01003                                  Symbol H3f3al3 Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism rno  Rattus norvegicus (rat) Pathway rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05202   Transcriptional misregulation in cancer rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     367254 (H3f3al3)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     367254 (H3f3al3)   09163 Immune disease    05322 Systemic lupus erythematosus     367254 (H3f3al3)   09165 Substance dependence    05034 Alcoholism     367254 (H3f3al3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     367254 (H3f3al3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     367254 (H3f3al3) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     367254 (H3f3al3) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    367254 (H3f3al3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CBFD_NFYB_HMF PAF Phage_GP58 Motif Other DBs NCBI-GeneID:  367254 NCBI-ProteinID:  XP_346042 RGD:  1564447 Ensembl:  ENSRNOG00000032108 UniProt:  A0A0G2K5X7 LinkDB All DBs Position 9:complement(49989995..49990754) Genome browser AA seq 136 aa AA seqDB search MPHTKQSVRKSTGGKAPRKQLATKAAPKSALSTGGVKKPHRYRPGTGALGETRCYQKFTE LLICELPFQRLVREIAQDFKTDLRFQSAATDVLQEASEAYLVGHSEDTNLCVIHAKHVTI MSKDIQLAHHIRGEHA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgcctcatacaaagcagtctgtccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcccaagagtgcgctctctactggaggggtgaagaaacctcat cgttacaggcctggtaccggggcactcggtgaaaccagatgctatcagaagttcactgaa cttctgatttgcgagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagtgcagctactgatgttttgcaggaggcaagtgaggcctat ctggttggccattctgaagataccaacctgtgtgttatccatgccaaacatgtaacaatt atgtcaaaagatatccagctagcacaccacatacgtggagaacatgcttaa

DBGET integrated database retrieval system