Rattus norvegicus (rat): 500987 Help Entry 500987            CDS       T01003                                  Symbol H2ax Name (RefSeq) H2A.X variant histone   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     500987 (H2ax)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     500987 (H2ax)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     500987 (H2ax)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     500987 (H2ax)   09165 Substance dependence    05034 Alcoholism     500987 (H2ax)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     500987 (H2ax)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     500987 (H2ax) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     500987 (H2ax) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    500987 (H2ax) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  500987 NCBI-ProteinID:  NP_001102761 RGD:  1566119 Ensembl:  ENSRNOG00000010386 UniProt:  A0ABK0LP06 A6J3X1 LinkDB All DBs Position 8:53568718..53570072 Genome browser AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKASQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtcgcggcaagaccggcggcaaggcccgcgccaaagccaagtcgcgctcttcg cgcgccggccttcagttcccggtaggccgcgtgcaccgactgctgcggaaaggccattac gccgagcgcgtgggcgcaggcgcgcccgtgtacctggcggcggtgctcgagtacctcact gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcattatc ccgcgccacctgcagctggctatccgcaacgacgaggagctcaacaagctgctgggcggc gtgactatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accagcgccaccgtggggcccaaggcgccggcgggcggcaagaaggcctcccaggcctct caggagtactga

DBGET integrated database retrieval system