KEGG   Rattus norvegicus (rat): 54226
Entry
54226             CDS       T01003                                 
Symbol
App
Name
(RefSeq) amyloid-beta A4 protein precursor
  KO
K04520  amyloid beta A4 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04726  Serotonergic synapse
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    54226 (App)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54226 (App)
   05022 Pathways of neurodegeneration - multiple diseases
    54226 (App)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    54226 (App)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    54226 (App)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    54226 (App)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   54226 (App)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Others
   54226 (App)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   54226 (App)
SSDB
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid Beta-APP Kunitz_BPTI Insulin_TMD Spore_III_AB
Other DBs
NCBI-GeneID: 54226
NCBI-ProteinID: NP_062161
RGD: 2139
Ensembl: ENSRNOG00000006997
UniProt: P08592
Structure
LinkDB
Position
11:complement(24019774..24236584)
AA seq 770 aa
MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTK
TCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDSIDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEE
EAEDDEDVEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVSSQSLLKTTSEPLPQD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgcccagcctggcactgctcctgctggccgcctggacggttcgggctctggaggtg
cccactgatggcaatgccggtctgctggcagaaccccagatcgccatgttctgtggtaaa
ctcaacatgcacatgaatgtgcagaatggaaaatgggagtcagacccatcagggaccaaa
acctgcattggcaccaaggagggaatcctgcagtactgccaagaggtctaccctgaactg
cagatcacaaacgtggtggaagccaaccagccagtgaccatccagaactggtgcaagcgg
ggccgcaagcagtgcaagacgcacacccacatcgtgattccttaccggtgcctagttggt
gagtttgtaagcgatgcccttctcgtgcccgacaagtgcaagtttctacaccaggagcgg
atggacgtttgtgagacccatcttcactggcatactgttgccaaagagacatgcagtgag
aagagcactaacttgcacgactatggcatgctgctgccctgtggcatcgacaagttccga
ggggtcgagttcgtgtgctgcccgttggcggaggagagcgacagcatcgattctgcggac
gcagaggaggacgactccgatgtctggtggggtggagcggacacagactatgctgatggc
ggtgaagacaaagtcgtagaagtagccgaagaggaggaagtggccgatgttgaggaagaa
gaagctgaggatgacgaggatgtggaggatggggatgaggtggaggaggaggccgaggag
ccctacgaagaggccacagagagaacaaccagcattgccaccactaccacaactaccact
gagtctgtggaggaggtagtccgagaggtgtgctctgaacaagctgagaccgggccatgc
cgtgcaatgatctcccgctggtactttgatgtcactgaaggaaagtgcgccccattcttt
tacggcggatgtggcggcaacaggaacaactttgacactgaagagtactgcatggcggtg
tgtggcagcgtgtcatcccaaagtttactcaagactaccagtgaacctcttccccaagat
ccggttaaacttcccacgacggcagccagcacccctgacgcagtcgacaagtacctggag
acccccggagatgagaacgagcacgcccatttccagaaagccaaagagaggttggaagcc
aagcaccgagagagaatgtcccaggtcatgagagaatgggaggaggcagaacgtcaagcc
aagaatttgcccaaagctgacaagaaggccgttatccagcatttccaggagaaagtggaa
tctctggaacaggaagcagccaacgagaggcagcagcttgtagagacacacatggccaga
gttgaagccatgctcaatgatcgccgtcgcctggccctcgagaattacatcaccgcactg
caggcggtgcctccaaggcctcatcatgtgttcaacatgctgaagaagtacgtccgtgca
gagcagaaggacagacagcacaccctaaagcattttgaacatgtgcgcatggtggacccc
aagaaagctgctcagatccggtcccaggttatgacacacctccgtgtgatctacgagcgc
atgaaccagtctctgtccctgctctacaacgtccctgccgtggctgaggagattcaagat
gaagttgacgagctgcttcagaaggagcagaactactccgacgacgtcttagccaacatg
atcagtgaacccagaatcagttacggcaacgatgctctcatgccttctttgactgaaacg
aagaccactgtggagctccttcccgtgaatggcgaattcagcctggatgatctccaaccg
tggcatccttttggggtggactctgtgccagccaatacagaaaatgaagttgagcctgtc
gacgcccgccccgctgctgaccgaggactgaccactcgaccagggtctgggttgacaaac
atcaagacagaagagatctcagaagtgaagatggatgcggagttcggacatgattcaggc
ttcgaagtccgccatcaaaaactggtgttctttgcagaagatgtgggttcaaacaaaggt
gccatcattggactcatggtgggtggcgttgtcatagcaacagtgattgtcatcaccttg
gtgatgctgaagaagaaacagtacacatccatccatcatggcgtggtggaggttgacgct
gctgtgaccccggaggagcgccacctctccaagatgcagcagaatggatatgagaatcca
acatacaagttctttgagcagatgcagaactaa

DBGET integrated database retrieval system