Rattus norvegicus (rat): 58940 Help Entry 58940             CDS       T01003                                  Symbol H2az1 Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     58940 (H2az1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     58940 (H2az1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     58940 (H2az1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     58940 (H2az1)   09165 Substance dependence    05034 Alcoholism     58940 (H2az1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     58940 (H2az1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     58940 (H2az1) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     58940 (H2az1) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    58940 (H2az1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  58940 NCBI-ProteinID:  NP_073165 RGD:  621464 Ensembl:  ENSRNOG00000010306 UniProt:  P0C0S7 A6HW07 LinkDB All DBs Position 2:229026464..229031411 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc tcccagcgagcgggcttgcagttccctgtgggccgtattcatcgacacctgaaatctagg acaacaagccacggacgtgtgggcgcgaccgcagctgtgtacagcgcagccatcctggag tacctcaccgcagaggtacttgagttggcaggaaatgcatcaaaagacttgaaggtaaag cgtattacccctcgtcacttgcaacttgctatccgcggagatgaagagttggactctctg atcaaggctacgattgctggtggtggtgtcatcccacacatccacaaatcactgattggg aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system