KEGG   Rattus norvegicus (rat): 60329
Entry
60329             CDS       T01003                                 

Gene name
Neurog3
Definition
(RefSeq) neurogenin-3
  KO
K08028  neurogenin 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    60329 (Neurog3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    60329 (Neurog3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    60329 (Neurog3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 60329
NCBI-ProteinID: NP_067732
RGD: 631350
Ensembl: ENSRNOG00000024413
UniProt: O08718
LinkDB
Position
20
AA seq 214 aa
MAPHPLDAPTIQVSQETQQPFPGASDHEVLSSNSTPPSPTLVPRDCSEAEAGDCRGTSRK
LRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSSGDWGSIYSPVSQAG
SLSPTASLEEFPGLQVPSSPSCLLPGTLVFSDFL
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcgcctcatcccttggatgcgcccaccatccaagtgtcccaagagacccagcaaccc
tttcccggagcctcggaccacgaagtgctcagttccaattccaccccacctagccccact
ctcgtaccgagggactgctccgaagcagaagcaggtgactgccgagggacatcgaggaag
ctccgtgcgcggcgcggagggcgcaacaggcccaagagcgagttggcactgagcaagcag
cgacgaagccggcgcaagaaggccaacgaccgggagcgcaaccgcatgcacaaccttaac
tccgcgctggatgcgctgcgcggtgtcctgcccaccttcccggatgacgccaaacttaca
aagatcgagaccctgcgcttcgcccacaactacatttgggcactgactcagacgctgcgc
atagcggaccacagcttctacggccccgagccccctgtgccctgtggggagctgggaagc
ccgggagggggctccagcggcgactggggctctatctactccccagtttcccaagctggt
agcctgagccccacagcctcattggaggagttccctggcctgcaggtgcccagctcccca
tcctgtctgctcccgggcaccctggtgttctcagacttcttgtga

DBGET integrated database retrieval system