KEGG   Rattus norvegicus (rat): 60349
Entry
60349             CDS       T01003                                 

Gene name
Nr5a2
Definition
(RefSeq) nuclear receptor subfamily 5 group A member 2
  KO
K08027  nuclear receptor subfamily 5 group A member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    60349 (Nr5a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    60349 (Nr5a2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    60349 (Nr5a2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    60349 (Nr5a2)
Nuclear receptors [BR:rno03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   60349 (Nr5a2)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 60349
NCBI-ProteinID: NP_068510
RGD: 68353
Ensembl: ENSRNOG00000000653
UniProt: Q9QWM1
LinkDB
Position
13
AA seq 560 aa
MSASSITGDFQDFLKHGLPAIAPAPGSETPHSPKLEEKHREKRAGLPDRHRRPIPARSRL
VMLPKVETEASGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYG
LLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRAD
RMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASK
GLPLSHVALPPTDYDRSPFVTSPISMTMPPHGSLHGYQPYGHFPNRAIKSEYPDPYSSSP
ESMMGYSYMDGYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQNNRNRQEKLSA
FGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEG
TIFLVTGEHVDYSSIISNTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDV
KNLENFQLVEGVQEQVNAALLDYTLCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKH
VNGDVPYNNLLIEMLHAKRA
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtctgctagttcgattactggggattttcaagactttcttaagcatggacttccagct
attgcacctgcaccaggatcagagactccacactcccccaaacttgaggaaaaacaccgg
gaaaaacgtgctgggcttccggaccgacaccgacggcccattcccgcccgcagccgcctt
gtcatgctgcccaaagtggagacggaagcctcaggactggtccgatcgcatggggaacag
gggcagatgccggaaaacatgcaagtgtctcaatttaaaatggtgaattactcctatgat
gaagatctggaagagctgtgtcctgtgtgtggcgataaagtatctgggtatcattacggt
ctcctcacctgtgaaagctgcaagggtttctttaagcgaacagtccaaaaccagaaaagg
tacacgtgcatagagaaccagaactgccaaattgacaagacacagagaaaacgatgtcct
tactgtcggttcaaaaaatgtatcgacgttggaatgaagctggaggccgtgagagctgac
cgcatgcgaggaggcagaaataagttcgggccaatgtacaagagagacagggccttgaaa
cagcagaagaaagccctcattcgagccaatggacttaagctggaagccatgtctcaggtg
atccaagcgatgccctcagacctgacctctgcaattcagaacattcattctgcctccaaa
ggcctacctctgagccatgtagccttgcctccgacagactatgacagaagtccctttgtc
acttctcccattagcatgacaatgccacctcatggcagtctgcatggttaccaaccatat
ggtcactttcctaatcgggccatcaagtctgagtacccagacccctactccagctcgcca
gagtcaatgatgggctactcctacatggatggttaccagacaagctccccggcaagcatc
cctcatctgatattggaacttttgaagtgtgaacccgatgagcctcaagttcaagcgaaa
atcatggcttacctacagcaagagcagaataaccggaacaggcaggaaaagctgagcgcg
tttgggctcttgtgcaaaatggcggaccagaccctgttctccattgttgagtgggccagg
agtagtatcttcttcagggaactgaaggttgatgaccaaatgaagctgcttcagaactgc
tggagtgagctcttgatcctggatcacatttaccggcaagtagcacatgggaaggaaggg
acaatcttcctggttaccggagaacacgtggactactccagcatcatctcaaacacagaa
gtcgcattcaacaacctcctgagcctcgcccaggagctcgtggtgagactccgttccctt
cagtttgatcagcgggagtttgtgtgtctgaagttcctggtgctgttcagctcagatgtc
aagaatcttgagaacttccagctggtggaaggcgtccaagagcaggtcaatgctgccctg
ctggactacacactttgcaactacccacaacaaactgagaaatttggacaactgcttctt
cgactaccagaaatccgggcaatcagcaaacaggcagaagactacctgtactacaagcac
gtgaatggggatgtgccctacaataaccttctcattgaaatgctgcacgccaaaagagcc
taa

DBGET integrated database retrieval system