Rattus norvegicus (rat): 641635 Help Entry 641635            CDS       T01003                                  Symbol Defb10 Name (RefSeq) beta-defensin 10 precursor   KO K23125   beta-defensin 1 Organism rno  Rattus norvegicus (rat) Pathway rno02010   ABC transporters rno05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     641635 (Defb10)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     641635 (Defb10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:rno02000]     641635 (Defb10)    03037 Cilium and associated proteins [BR:rno03037]     641635 (Defb10) Transporters [BR:rno02000]  Other transporters   Pores ion channels [TC:1]    641635 (Defb10) Cilium and associated proteins [BR:rno03037]  Motile cilia and associated proteins   Sperm associated proteins    641635 (Defb10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  641635 NCBI-ProteinID:  NP_001032599 RGD:  1562518 Ensembl:  ENSRNOG00000038148 UniProt:  Q32ZI1 LinkDB All DBs Position 16:complement(76905070..76915205) Genome browser AA seq 71 aa AA seqDB search MKTLCSLLLIGCLLFSYDTPVVGELKHLGMTAETEWCRLFEGFCHDKNCPPPTSHVGSCH PEKRSCCKDRR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaagactctctgctctctgctgctgataggctgcctccttttctcctatgacactcca gttgttggagaactaaaacatcttggaatgacagcagaaactgagtggtgccgactcttt gaagggttctgtcacgataaaaattgtcctcctcctacctcgcatgtgggttcctgtcac cctgagaagcgcagttgttgcaaggacaggagatga

DBGET integrated database retrieval system