| Entry |
|
|---|
| Symbol |
Gng11
|
|---|
| Name |
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
|
|---|
| KO |
| K04546 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 |
|
|---|
| Organism |
rno Rattus norvegicus (rat)
|
|---|
| Pathway |
| rno04723 | Retrograde endocannabinoid signaling |
| rno05163 | Human cytomegalovirus infection |
| rno05167 | Kaposi sarcoma-associated herpesvirus infection |
| rno05170 | Human immunodeficiency virus 1 infection |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:rno00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
64199 (Gng11)
04371 Apelin signaling pathway
64199 (Gng11)
04151 PI3K-Akt signaling pathway
64199 (Gng11)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
64199 (Gng11)
04081 Hormone signaling
64199 (Gng11)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
64199 (Gng11)
09152 Endocrine system
04926 Relaxin signaling pathway
64199 (Gng11)
09156 Nervous system
04724 Glutamatergic synapse
64199 (Gng11)
04727 GABAergic synapse
64199 (Gng11)
04725 Cholinergic synapse
64199 (Gng11)
04728 Dopaminergic synapse
64199 (Gng11)
04726 Serotonergic synapse
64199 (Gng11)
04723 Retrograde endocannabinoid signaling
64199 (Gng11)
09159 Environmental adaptation
04713 Circadian entrainment
64199 (Gng11)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
64199 (Gng11)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
64199 (Gng11)
05163 Human cytomegalovirus infection
64199 (Gng11)
05167 Kaposi sarcoma-associated herpesvirus infection
64199 (Gng11)
09165 Substance dependence
05032 Morphine addiction
64199 (Gng11)
05034 Alcoholism
64199 (Gng11)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:rno04031]
64199 (Gng11)
GTP-binding proteins [BR:rno04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
64199 (Gng11)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
4:32977681..32983121
|
|---|
| AA seq |
73 aa
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS |
|---|
| NT seq |
222 nt +upstreamnt +downstreamnt
atgcccgcccttcacattgaggatctgccggaaaaggaaaaactgaagatggaggttgag
caacttcgcaaagaagtgaagttgcagagacaacaggtgtctaaatgttctgaggaaata
aagaactacattgaagaacgttctggagaggatcctctggtaaagggaattccagaagac
aagaatcccttcaaagaaaagggcagctgtgtcatttcctaa |
|---|
